Protein Info for Rv1962c in Mycobacterium tuberculosis H37Rv

Annotation: Possible toxin VapC35. Contains PIN domain.

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 135 PF01850: PIN" amino acids 2 to 122 (121 residues), 56.5 bits, see alignment E=2.3e-19

Best Hits

Swiss-Prot: 99% identical to VPC35_MYCTO: Ribonuclease VapC35 (vapC35) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K07064, (no description) (inferred from 99% identity to mbb:BCG_2001c)

Predicted SEED Role

"FIG00820878: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (135 amino acids)

>Rv1962c Possible toxin VapC35. Contains PIN domain. (Mycobacterium tuberculosis H37Rv)
VIYLETSALVKLIRIEVESDALADWLDDRTELRWITSALTEVELSRAIRAVSPEGLPAVP
SVLARLDRFEIDAVIRSTAAAYPNPALRSLDAIHLATAQTAGSVAPLTALVTYDNRLKEA
AEALSLAVVAPGQAR