Protein Info for Rv1939 in Mycobacterium tuberculosis H37Rv

Annotation: Probable oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 171 PF01613: Flavin_Reduct" amino acids 25 to 168 (144 residues), 118.1 bits, see alignment E=2e-38

Best Hits

Swiss-Prot: 35% identical to FRED_PSEPU: Flavin reductase from Pseudomonas putida

KEGG orthology group: None (inferred from 99% identity to mtf:TBFG_11968)

Predicted SEED Role

"Nitrilotriacetate monooxygenase component B (EC 1.14.13.-)" in subsystem Aromatic Amin Catabolism (EC 1.14.13.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.13.-

Use Curated BLAST to search for 1.14.13.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (171 amino acids)

>Rv1939 Probable oxidoreductase (Mycobacterium tuberculosis H37Rv)
VSCTFDMVPETVDHLDEVGLRRVFGCFPCGVIAVCAMVDDQPVGMAASSFTSVSVDPPLV
SICVQNCSTTWPKLRDRPRLGVSVLAEGHDAACMSLSRKEGNRFAGVFWSELSSGGVVIA
GAGAWLDCRPYAEIPAGDHLIALLEICAVRADPETPPLVFHGSRFRRLESR