Protein Info for Rv1925 in Mycobacterium tuberculosis H37Rv

Annotation: Probable acyl-CoA ligase FadD31 (acyl-CoA synthetase) (acyl-CoA synthase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 620 PF00501: AMP-binding" amino acids 68 to 448 (381 residues), 155.6 bits, see alignment E=8.8e-50

Best Hits

Swiss-Prot: 48% identical to FAA32_MYCBO: Long-chain-fatty-acid--AMP ligase FadD32 (fadD32) from Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

KEGG orthology group: K00666, fatty-acyl-CoA synthase [EC: 6.2.1.-] (inferred from 100% identity to mtu:Rv1925)

MetaCyc: 48% identical to acyl-CoA synthetase (Mycobacterium tuberculosis H37Rv)
6.2.1.-; 6.2.1.-; 6.2.1.-; 6.2.1.-; 6.2.1.-

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.2.1.-

Use Curated BLAST to search for 6.2.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (620 amino acids)

>Rv1925 Probable acyl-CoA ligase FadD31 (acyl-CoA synthetase) (acyl-CoA synthase) (Mycobacterium tuberculosis H37Rv)
MNDGSRQELRVRSGLLQIEDCLDADGGIALPAGTTLISLIERNIKYVGDLVAYRYLDHAR
SAAGCALEVTWTQFGMRLAAIGAHVQRFAGPGDRVAILAPQGIDYVCGFYAAIKAGTVAV
PLFAPELPGHAERLDTALRDSEPAVILTTAAAKNAVEGFLNNVPRLRKPTVLVIDQIPDR
EGELFVPVELDIDAVSHLQYTSGSTRPPVGVEITHRAVGTNLVQMILSIDLLNRNTHGVS
WLPLYHDMGLSMIGFPAVYGGHSTLMSPTAFVRRPLRWIQALSEGSRTGRVVTAAPNFAY
EWAAQRGLPAQGDDVDLSNVVLIIGSEPVSIDAVTTFNKAFAPYGLPRTAFKPSYGIAEA
TLLVATIDHAAEPTVVYLDPEQLGAGHATRVAPDAPNAVVHVSCGHVARSLWAVIVDPDT
GPEAGAELPDGEIGEVWLQGDNVARGYWGRPEETRMTFGARLQSPLAEGSHADGSAIDDT
WLRTGDLGVYLDGELYITGRIADLLTIDGRNHYPQDIEATAAEASPMVRRGYITAFTVPA
SDGDDRNQRLVIIAERAAGTSRSDPRPALDAIRAAVCNRHGLSVADLSFLPAGAIPRTTS
GKLARQACRAQYLSGRLGVH