Protein Info for Rv1912c in Mycobacterium tuberculosis H37Rv

Annotation: Possible oxidoreductase FadB5

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF08240: ADH_N
  • amino acids 28 to 97 (70 residues), 34.7 bits, E=2e-12
• PF00107: ADH_zinc_N
  • amino acids 152 to 262 (111 residues), 66 bits, E=5.1e-22
• PF13602: ADH_zinc_N_2
  • amino acids 184 to 332 (149 residues), 56.3 bits, E=1.1e-18

Best Hits

KEGG orthology group: K00540, [EC: 1.-.-.-] (inferred from 100% identity to mbb:BCG_1951c)

Predicted SEED Role

"(MTCY180.06), len: 334. fadB5, Possible oxidoreductase, similar to hydroxyacyl-CoA dehydrogenase, quinone oxidoreductases (EC 1.6.5.5) and polyketide synthases.Contains quinone oxidoreductase / zeta-crystallin signature(PS01162). FASTA results: Q53927 HYDROXYACYL-COA DEHYDROGENASE. (329 aa) opt: 621; E(): 2e-30; 39.5\% identity in349 aa overlap. Similar to many hypothetical M. tuberculosisproteins including: MTCY24G1.09, MTCY13D12.11, MTCY19H9.01, MTCY24G1.03, MTCY03A2.17c, etc. TBparse score is 0.921" (EC 1.6.5.5)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Carotenoid biosynthesis - General
• Insect hormone biosynthesis
• Nucleotide sugars metabolism
• Porphyrin and chlorophyll metabolism
• Puromycin biosynthesis
• Trinitrotoluene degradation
• alpha-Linolenic acid metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-, 1.6.5.5

Use Curated BLAST to search for 1.-.-.- or 1.6.5.5

Protein Sequence (334 amino acids)

>Rv1912c Possible oxidoreductase FadB5 (Mycobacterium tuberculosis H37Rv)
MRAVVITKHGDPSVLQVRQRPDPPPPGPGQLRVAVRAAGVNFADHLARVGLYPDAPKLPA
VVGYEVAGTVEAVGDGVDPNRVGERVLAGTRFGGYCEIVNVAATDSVVLPDALSFEQGAA
VPVNYATAWAALHGYGSLRAGERVLIHAAAGGVGIAAVQFAKAAKAEVHGTASPQKHQKL
AEFGVDRAIDYRRDGWWQGLGPYDVVLDALGGTSLRRSYTLLRPGGRLVGYGISNMQHGE
KRSMRRVAPHALSMLRGFNLMKQLEESKTVIGLNMLRLWDDRRTLEPWIAPLTKALNDGT
ILPIVHAIVPFAEAPEAHRILAARENVDKVVLVP