Protein Info for Rv1911c in Mycobacterium tuberculosis H37Rv

Annotation: Probable lipoprotein LppC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 201 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF01161: PBP" amino acids 69 to 199 (131 residues), 109.8 bits, see alignment E=7e-36 TIGR00481: Raf kinase inhibitor-like protein, YbhB/YbcL family" amino acids 74 to 193 (120 residues), 65.1 bits, see alignment E=3e-22

Best Hits

Swiss-Prot: 100% identical to LPPC_MYCTO: Putative lipoprotein LppC (lppC) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K06910, (no description) (inferred from 100% identity to mbb:BCG_1950c)

Predicted SEED Role

"FIG00822184: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (201 amino acids)

>Rv1911c Probable lipoprotein LppC (Mycobacterium tuberculosis H37Rv)
MTSTLHRTPLATAGLALVVALGGCGGGGGDSRETPPYVPKATTVDATTPAPAAEPLTIAS
PMFADGAPIPVQFSCKGANVAPPLTWSSPAGAAELALVVDDPDAVGGLYVHWIVTGIAPG
SGSTADGQTPAGGHSVPNSGGRQGYFGPCPPAGTGTHHYRFTLYHLPVALQLPPGATGVQ
AAQAIAQAASGQARLVGTFEG