Protein Info for Rv1902c in Mycobacterium tuberculosis H37Rv

Annotation: Probable sialic acid-transport integral membrane protein NanT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 422 transmembrane" amino acids 14 to 38 (25 residues), see Phobius details amino acids 49 to 71 (23 residues), see Phobius details amino acids 85 to 110 (26 residues), see Phobius details amino acids 144 to 163 (20 residues), see Phobius details amino acids 169 to 187 (19 residues), see Phobius details amino acids 212 to 234 (23 residues), see Phobius details amino acids 261 to 282 (22 residues), see Phobius details amino acids 290 to 307 (18 residues), see Phobius details amino acids 312 to 335 (24 residues), see Phobius details amino acids 347 to 366 (20 residues), see Phobius details amino acids 378 to 398 (21 residues), see Phobius details TIGR00891: MFS transporter, sialate:H+ symporter (SHS) family" amino acids 2 to 388 (387 residues), 594.9 bits, see alignment E=4.3e-183 PF00083: Sugar_tr" amino acids 14 to 210 (197 residues), 91.7 bits, see alignment E=5.2e-30 amino acids 243 to 396 (154 residues), 55.1 bits, see alignment E=6.2e-19 PF07690: MFS_1" amino acids 21 to 234 (214 residues), 93.8 bits, see alignment E=1e-30 amino acids 244 to 395 (152 residues), 40.9 bits, see alignment E=1.3e-14

Best Hits

KEGG orthology group: K08178, MFS transporter, SHS family, lactate transporter (inferred from 100% identity to mtf:TBFG_11931)

Predicted SEED Role

"Sialic acid transporter (permease) NanT" in subsystem Sialic Acid Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (422 amino acids)

>Rv1902c Probable sialic acid-transport integral membrane protein NanT (Mycobacterium tuberculosis H37Rv)
VAAPRLTGDQRNAFMASFLGWTMDAFDYFLVVLVYADIATTFHHTKTDVAFLTTATLAMR
PVGALLFGLWADRVGRRVPLMVDVSFYSVIGFLCAFAPNFTVLVILRLLYGIGMGGEWGL
GAALSMEKVPAERRGVFSGLLQEGYAFGYLLASVAALVVMNWLGLSWRWLFGLSIIPALI
SLIIRYRVKESEVWEAAQDRMRLTKTRIRDVLGNPAIVRRFVYLVLLMTAFNWMSHGTQD
VYPTFLTATTDHGAGLSSLTARWIVVIYNIGAIIGGLAFGTLSQRFSRRYTIVFCAALGL
PIVPLFAYSRTAAMLCLGSFLMQVFVQGAWGVIPAHLTEMSPDAIRGVYPGVTYQLGNLL
AAFNLPIQERLAESHGYPFALAATIVPVLLVVAVLTAIGKDATGIRFGTTETAFLVRHRN
RH