Protein Info for Rv1876 in Mycobacterium tuberculosis H37Rv

Annotation: Probable bacterioferritin BfrA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00754: bacterioferritin
  • amino acids 1 to 156 (156 residues), 263.9 bits, E=2.4e-83
• PF00210: Ferritin
  • amino acids 10 to 143 (134 residues), 121.3 bits, E=1.5e-39

Best Hits

Swiss-Prot: 100% identical to BFR_MYCTU: Bacterioferritin (bfr) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K03594, bacterioferritin (inferred from 100% identity to mtb:TBMG_02118)

MetaCyc: 45% identical to bacterioferritin (Escherichia coli K-12 substr. MG1655)
Ferroxidase. [EC: 1.16.3.1]

Predicted SEED Role

"Bacterioferritin (BFR) (EC 1.16.3.1)" (EC 1.16.3.1)

KEGG Metabolic Maps

• Porphyrin and chlorophyll metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.16.3.1

Protein Sequence (159 amino acids)

>Rv1876 Probable bacterioferritin BfrA (Mycobacterium tuberculosis H37Rv)
MQGDPDVLRLLNEQLTSELTAINQYFLHSKMQDNWGFTELAAHTRAESFDEMRHAEEITD
RILLLDGLPNYQRIGSLRIGQTLREQFEADLAIEYDVLNRLKPGIVMCREKQDTTSAVLL
EKIVADEEEHIDYLETQLELMDKLGEELYSAQCVSRPPT