Protein Info for Rv1872c in Mycobacterium tuberculosis H37Rv

Annotation: Possible L-lactate dehydrogenase (cytochrome) LldD2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 414 PF01070: FMN_dh" amino acids 44 to 402 (359 residues), 422 bits, see alignment E=9.4e-131

Best Hits

Swiss-Prot: 100% identical to LLDD_MYCTO: Putative L-lactate dehydrogenase (lldD) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K00101, L-lactate dehydrogenase (cytochrome) [EC: 1.1.2.3] (inferred from 100% identity to mbb:BCG_1908c)

Predicted SEED Role

"L-lactate dehydrogenase (EC 1.1.2.3)" in subsystem L-rhamnose utilization or Lactate utilization or Respiratory dehydrogenases 1 (EC 1.1.2.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.2.3

Use Curated BLAST to search for 1.1.2.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (414 amino acids)

>Rv1872c Possible L-lactate dehydrogenase (cytochrome) LldD2 (Mycobacterium tuberculosis H37Rv)
MAVNRRVPRVRDLAPLLQFNRPQFDTSKRRLGAALTIQDLRRIAKRRTPRAAFDYADGGA
EDELSIARARQGFRDIEFHPTILRDVTTVCAGWNVLGQPTVLPFGIAPTGFTRLMHTEGE
IAGARAAAAAGIPFSLSTLATCAIEDLVIAVPQGRKWFQLYMWRDRDRSMALVRRVAAAG
FDTMLVTVDVPVAGARLRDVRNGMSIPPALTLRTVLDAMGHPRWWFDLLTTEPLAFASLD
RWPGTVGEYLNTVFDPSLTFDDLAWIKSQWPGKLVVKGIQTLDDARAVVDRGVDGIVLSN
HGGRQLDRAPVPFHLLPHVARELGKHTEILVDTGIMSGADIVAAIALGARCTLIGRAYLY
GLMAGGEAGVNRAIEILQTGVIRTMRLLGVTCLEELSPRHVTQLRRLGPIGAPT