Protein Info for Rv1867 in Mycobacterium tuberculosis H37Rv
Annotation: Conserved protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: K00626, acetyl-CoA C-acetyltransferase [EC: 2.3.1.9] (inferred from 100% identity to mbt:JTY_1887)Predicted SEED Role
"Acetyl-CoA acetyltransferase"
MetaCyc Pathways
- oleate β-oxidation (27/35 steps found)
- ketolysis (2/3 steps found)
- pyruvate fermentation to butanol II (engineered) (4/6 steps found)
- acetoacetate degradation (to acetyl CoA) (1/2 steps found)
- superpathway of Clostridium acetobutylicum acidogenic fermentation (6/9 steps found)
- valproate β-oxidation (6/9 steps found)
- glutaryl-CoA degradation (3/5 steps found)
- pyruvate fermentation to hexanol (engineered) (7/11 steps found)
- acetyl-CoA fermentation to butanoate (4/7 steps found)
- pyruvate fermentation to butanoate (4/7 steps found)
- polyhydroxybutanoate biosynthesis (1/3 steps found)
- glycerol degradation to butanol (10/16 steps found)
- (R)- and (S)-3-hydroxybutanoate biosynthesis (engineered) (2/5 steps found)
- ketogenesis (2/5 steps found)
- pyruvate fermentation to butanol I (4/8 steps found)
- (2S)-ethylmalonyl-CoA biosynthesis (1/4 steps found)
- L-glutamate degradation V (via hydroxyglutarate) (5/10 steps found)
- superpathway of geranylgeranyldiphosphate biosynthesis I (via mevalonate) (5/10 steps found)
- 1-butanol autotrophic biosynthesis (engineered) (17/27 steps found)
- isopropanol biosynthesis (engineered) (1/5 steps found)
- pyruvate fermentation to acetone (1/5 steps found)
- 3-hydroxypropanoate/4-hydroxybutanate cycle (10/18 steps found)
- mevalonate pathway I (eukaryotes and bacteria) (2/7 steps found)
- mevalonate pathway II (haloarchaea) (2/7 steps found)
- L-lysine fermentation to acetate and butanoate (4/10 steps found)
- superpathway of Clostridium acetobutylicum solventogenic fermentation (6/13 steps found)
- photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (15/26 steps found)
- 2-deoxy-D-ribose degradation II (2/8 steps found)
- 2-methylpropene degradation (2/8 steps found)
- isoprene biosynthesis II (engineered) (2/8 steps found)
- mevalonate pathway III (Thermoplasma) (2/8 steps found)
- mevalonate pathway IV (archaea) (2/8 steps found)
- superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (8/17 steps found)
- L-glutamate degradation VII (to butanoate) (4/12 steps found)
- methyl tert-butyl ether degradation (2/10 steps found)
- 4-oxopentanoate degradation (1/9 steps found)
- ethylmalonyl-CoA pathway (2/11 steps found)
- L-tryptophan degradation III (eukaryotic) (4/15 steps found)
- crotonate fermentation (to acetate and cyclohexane carboxylate) (3/16 steps found)
- benzoate fermentation (to acetate and cyclohexane carboxylate) (3/17 steps found)
- toluene degradation VI (anaerobic) (3/18 steps found)
- superpathway of ergosterol biosynthesis I (6/26 steps found)
- Methanobacterium thermoautotrophicum biosynthetic metabolism (23/56 steps found)
- superpathway of L-lysine degradation (10/43 steps found)
- superpathway of cholesterol biosynthesis (6/38 steps found)
KEGG Metabolic Maps
- Benzoate degradation via CoA ligation
- Butanoate metabolism
- Fatty acid metabolism
- Lysine degradation
- Propanoate metabolism
- Pyruvate metabolism
- Synthesis and degradation of ketone bodies
- Terpenoid biosynthesis
- Tryptophan metabolism
- Valine, leucine and isoleucine degradation
Isozymes
Compare fitness of predicted isozymes for: 2.3.1.9
Use Curated BLAST to search for 2.3.1.9
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (494 amino acids)
>Rv1867 Conserved protein (Mycobacterium tuberculosis H37Rv) MPVDPRTPVLIGYGQVNHRGDIDAEKQSIEPVDLMAAAARKAADSTVLEAVDSIRVVHML SAHYRNPGQLLGERIKARTFTTGYSGVGGNMPQSLVNRACLDIQRGRAGVVLLAGAETWR TRTGLRAKGSKLEWTVQDESVPLPDMAGDDVPMAGAAELRINLDRPAYVYPIFEQALRIA YGESIENHRKRIGELWARFSAVAADNPHAWIRNPVTADEIWQPGPQNRMVSWPYTKLMNS NNMVDQGAALLLTSVERATRLRIPAERWVYPQAGTDAHDTPAVADRHRLHRSTAIRIAGA RALELAGLGLDDIEYVDLYSCFPSAVQVAAIELGLDTDDPARPLTVTGGLTFAGGPWSNY VTHSIATMAELLAANPGRRGLITANGGYLTKHSFGVYGTEPPSEFRWEDMQPAVDREPTG DGLVEWEGIGTVEAWTTPVNRDGQPEKAFLAVRTPDGSRSLAVITDPASVQATVREDIAG VKVAVAPDGTATLR