Protein Info for Rv1863c in Mycobacterium tuberculosis H37Rv

Annotation: Probable conserved integral membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 transmembrane" amino acids 28 to 46 (19 residues), see Phobius details amino acids 52 to 69 (18 residues), see Phobius details amino acids 90 to 110 (21 residues), see Phobius details amino acids 122 to 141 (20 residues), see Phobius details amino acids 160 to 179 (20 residues), see Phobius details amino acids 199 to 223 (25 residues), see Phobius details amino acids 231 to 254 (24 residues), see Phobius details PF02517: Rce1-like" amino acids 130 to 243 (114 residues), 57.6 bits, see alignment E=6.6e-20

Best Hits

KEGG orthology group: K07052, (no description) (inferred from 100% identity to mra:MRA_1874)

Predicted SEED Role

"FIG01121868: possible membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (256 amino acids)

>Rv1863c Probable conserved integral membrane protein (Mycobacterium tuberculosis H37Rv)
MSDHLTACAAVHPGPLVSHLSVMHRFRIYVDIAVVVLVLVLTNLIAHFTTPWASIATVPA
AAVGLVILVRSRGLGWAELGLSRQHWKSGLVYALAAVALVVAVISVGVLLPITRPMFMNH
HYATISGAVIASMVMIPLQTVIPEELAFRGVLHGALNRAWGFRGVAVAGSVLFGLWHIAT
SLGLTSSNVGFTRLFGGGIIGLVAGVMLAVLATGVAGFVFSWLRRRSGSLIAPIALHWSL
NGMGALAAALVWHLST