Protein Info for Rv1860 in Mycobacterium tuberculosis H37Rv

Annotation: Alanine and proline rich secreted protein Apa (fibronectin attachment protein) (immunogenic protein MPT32) (antigen MPT-32) (45-kDa glycoprotein) (45/47 kDa antigen)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 325 signal peptide" amino acids 1 to 40 (40 residues), see Phobius details PF07174: FAP" amino acids 1 to 298 (298 residues), 510.1 bits, see alignment E=1.3e-157

Best Hits

Swiss-Prot: 100% identical to APA_MYCTU: Alanine and proline-rich secreted protein Apa (apa) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 100% identity to mtf:TBFG_11888)

Predicted SEED Role

"Alanine and proline-rich secreted protein Apa (45 kDa glycoprotein) (45/47 kDa antigen) (Antigen MPT-32) (FAP-B) (Fibronectin attachment protein) (Immunogenic protein MPT32)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (325 amino acids)

>Rv1860 Alanine and proline rich secreted protein Apa (fibronectin attachment protein) (immunogenic protein MPT32) (antigen MPT-32) (45-kDa glycoprotein) (45/47 kDa antigen) (Mycobacterium tuberculosis H37Rv)
MHQVDPNLTRRKGRLAALAIAAMASASLVTVAVPATANADPEPAPPVPTTAASPPSTAAA
PPAPATPVAPPPPAAANTPNAQPGDPNAAPPPADPNAPPPPVIAPNAPQPVRIDNPVGGF
SFALPAGWVESDAAHFDYGSALLSKTTGDPPFPGQPPPVANDTRIVLGRLDQKLYASAEA
TDSKAAARLGSDMGEFYMPYPGTRINQETVSLDANGVSGSASYYEVKFSDPSKPNGQIWT
GVIGSPAANAPDAGPPQRWFVVWLGTANNPVDKGAAKALAESIRPLVAPPPAPAPAPAEP
APAPAPAGEVAPTPTTPTPQRTLPA