Protein Info for Rv1857 in Mycobacterium tuberculosis H37Rv

Annotation: Probable molybdate-binding lipoprotein ModA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 261 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF13531: SBP_bac_11" amino acids 41 to 258 (218 residues), 163.9 bits, see alignment E=7.9e-52 PF01547: SBP_bac_1" amino acids 46 to 249 (204 residues), 92.4 bits, see alignment E=8.5e-30 TIGR01256: molybdate ABC transporter, periplasmic molybdate-binding protein" amino acids 46 to 255 (210 residues), 119 bits, see alignment E=1.4e-38

Best Hits

Swiss-Prot: 100% identical to MODA_MYCTO: Molybdate-binding protein ModA (modA) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K02020, molybdate transport system substrate-binding protein (inferred from 100% identity to mtb:TBMG_02137)

Predicted SEED Role

"Molybdenum ABC transporter, periplasmic molybdenum-binding protein ModA (TC 3.A.1.8.1)" in subsystem Molybdenum cofactor biosynthesis or Transport of Molybdenum (TC 3.A.1.8.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (261 amino acids)

>Rv1857 Probable molybdate-binding lipoprotein ModA (Mycobacterium tuberculosis H37Rv)
VRWIGLSTGLVSAMLVAGLVACGSNSPASSPAGPTQGARSIVVFAAASLQSAFTQIGEQF
KAGNPGVNVNFAFAGSSELATQLTQGATADVFASADTAQMDSVAKAGLLAGHPTNFATNT
MVIVAAAGNPKKIRSFADLTRPGLNVVVCQPSVPCGSATRRIEDATGIHLNPVSEELSVT
DVLNKVITGQADAGLVYVSDALSVATKVTCVRFPEAAGVVNVYAIAVLKRTSQPALARQF
VAMVTAAAGRRILDQSGFAKP