Protein Info for Rv1847 in Mycobacterium tuberculosis H37Rv

Annotation: Conserved protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 140 transmembrane" amino acids 52 to 69 (18 residues), see Phobius details TIGR00369: uncharacterized domain 1" amino acids 19 to 130 (112 residues), 78.3 bits, see alignment E=2.5e-26 PF03061: 4HBT" amino acids 48 to 127 (80 residues), 61.4 bits, see alignment E=8.7e-21

Best Hits

Swiss-Prot: 99% identical to Y1847_MYCTO: Putative esterase MT1895 (MT1895) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: None (inferred from 99% identity to mbt:JTY_1867)

Predicted SEED Role

"Putative esterase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (140 amino acids)

>Rv1847 Conserved protein (Mycobacterium tuberculosis H37Rv)
VQPSPDSPAPLNVTVPFDSELGLQFTELGPDGARAQLDVRPKLLQLTGVVHGGVYCAMIE
SIASMAAFAWLNSHGEGGSVVGVNNNTDFVRSISSGMVYGTAEPLHRGRRQQLWLVTITD
DTDRVVARGQVRLQNLEARP