Protein Info for Rv1841c in Mycobacterium tuberculosis H37Rv

Annotation: Conserved hypothetical membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 345 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 97 to 116 (20 residues), see Phobius details PF01595: CNNM" amino acids 8 to 198 (191 residues), 142.7 bits, see alignment E=1e-45 PF00571: CBS" amino acids 243 to 272 (30 residues), 24 bits, see alignment (E = 4.1e-09) amino acids 285 to 335 (51 residues), 27.8 bits, see alignment 2.6e-10

Best Hits

Swiss-Prot: 100% identical to Y1841_MYCTU: Uncharacterized protein Rv1841c (Rv1841c) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 100% identity to mtc:MT1889)

Predicted SEED Role

"Magnesium and cobalt efflux protein CorC" in subsystem Copper homeostasis: copper tolerance or Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (345 amino acids)

>Rv1841c Conserved hypothetical membrane protein (Mycobacterium tuberculosis H37Rv)
MDVLSAVLLALLLIGANAFFVGAEFALISARRDRLEALAEQGKATAVTVIRAGEQLPAML
TGAQLGVTVSSILLGRVGEPAVVKLLQLSFGLSGVPPALLHTLSLAIVVALHVLLGEMVP
KNIALAGPERTAMLLVPPYLVYVRLARPFIAFYNNCANAILRLVGVQPKDELDIAVSTAE
LSEMIAESLSEGLLDHEEHTRLTRALRIRTRLVADVAVPLVNIRAVQVSAVGSGPTIGGV
EQALAQTGYSRFPVVDRGGRFIGYLHIKDVLTLGDNPQTVIDLAVVRPLPRVPQSLPLAD
ALSRMRRINSHLALVTADNGSVVGMVALEDVVEDLVGTMRDGTHR