Protein Info for Rv1835c in Mycobacterium tuberculosis H37Rv

Annotation: Conserved hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 628 TIGR00976: hydrolase CocE/NonD family protein" amino acids 34 to 627 (594 residues), 719.1 bits, see alignment E=2.5e-220 PF02129: Peptidase_S15" amino acids 38 to 351 (314 residues), 177 bits, see alignment E=6.1e-56 PF08530: PepX_C" amino acids 387 to 602 (216 residues), 134.4 bits, see alignment E=5.6e-43

Best Hits

Swiss-Prot: 100% identical to Y1835_MYCTU: Putative serine esterase Rv1835c (Rv1835c) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K06978, (no description) (inferred from 100% identity to mbt:JTY_1854)

Predicted SEED Role

"Glutaryl-7-ACA acylase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (628 amino acids)

>Rv1835c Conserved hypothetical protein (Mycobacterium tuberculosis H37Rv)
MTRRGGSDAAWYSAPDQRSAYPRYRGMRYSSCYVTMRDGVRIAIDLYLPAGLTSAARLPA
ILHQTRYYRSLQLRWPLRMLLGGKPLQHIAADKRRRRRFVASGYAWVDVDVRGSGASFGA
RVCEWSSDEIRDGAEIVDWIVRQPWCNGTVAALGNSYDGTSAELLLVNQHPAVRVIAPCF
SLFDVYTDIAFPGGIHAAWFTDTWGRYNEALDRNALHEVVGWWAKLPVTGMQPVQEDRDR
SLRDGAIAAHRGNYDVHQIAGSLTFRDDVSASDPYRGQPDARLEPIGTPIESGSINLISP
HNYWRDVQASGAAIYSYSGWFDGGYAHAAIKRFLTVSTPGSHLILGPWNHTGGWRVDPLR
GLSRPDFDHDGELLRFIDHHVKGADTGIGSEPPVHYFTMVENRWKSADTWPPPATTQSYY
LSADRQLRPDAPDCDSGADEYVVDQTAGTGERSRWRSQVGIGGHVCYPDRKAQDAKLLTY
TSAPLDHPLEVTGHVVVTLFITSTSSDGTFFVYLEDVDPRGRVAYITEGQLRAIHRRLSD
GPPPYRQVVPYRTFASGDAWPLVPGEIARLTFDLLPTSYLFQPGHRIRIAIAGADASHFA
ILPGCAPTVRVYRSRMHASRIDLPVIQP