Protein Info for Rv1824 in Mycobacterium tuberculosis H37Rv

Annotation: Conserved hypothetical membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 121 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 38 to 55 (18 residues), see Phobius details amino acids 67 to 85 (19 residues), see Phobius details amino acids 91 to 109 (19 residues), see Phobius details PF06947: DUF1290" amino acids 32 to 119 (88 residues), 114.3 bits, see alignment E=1.2e-37

Best Hits

Swiss-Prot: 100% identical to Y1824_MYCTU: Uncharacterized protein Rv1824 (Rv1824) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 100% identity to mtb:TBMG_02169)

Predicted SEED Role

"FIG025307: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (121 amino acids)

>Rv1824 Conserved hypothetical membrane protein (Mycobacterium tuberculosis H37Rv)
MGSDTAWSPARMIGIAALAVGIVLGLVFHPGVPEVIQPYLPIAVVAALDAVFGGLRAYLE
RIFDPKVFVVSFVFNVLVAALIVYVGDQLGVGTQLSTAIIVVLGIRIFGNTAALRRRLFG
A