Protein Info for Rv1821 in Mycobacterium tuberculosis H37Rv

Annotation: Possible preprotein translocase ATPase SecA2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 808 TIGR04221: accessory Sec system translocase SecA2" amino acids 43 to 808 (766 residues), 1387.6 bits, see alignment E=0 PF07517: SecA_DEAD" amino acids 48 to 424 (377 residues), 290.2 bits, see alignment E=3.4e-90 PF01043: SecA_PP_bind" amino acids 277 to 381 (105 residues), 84.1 bits, see alignment E=2.1e-27 PF21090: P-loop_SecA" amino acids 440 to 545 (106 residues), 125.6 bits, see alignment E=4.1e-40 amino acids 543 to 596 (54 residues), 73.8 bits, see alignment 3.1e-24 PF07516: SecA_SW" amino acids 670 to 752 (83 residues), 54 bits, see alignment E=4.9e-18

Best Hits

Swiss-Prot: 100% identical to SECA2_MYCBP: Protein translocase subunit SecA 2 (secA2) from Mycobacterium bovis (strain BCG / Pasteur 1173P2)

KEGG orthology group: K03070, preprotein translocase subunit SecA (inferred from 100% identity to mtu:Rv1821)

Predicted SEED Role

"Protein export cytoplasm protein SecA ATPase RNA helicase (TC 3.A.5.1.1)" (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (808 amino acids)

>Rv1821 Possible preprotein translocase ATPase SecA2 (Mycobacterium tuberculosis H37Rv)
VNVHGCPRIAACRCTDTHPRGRPAFAYRWFVPKTTRAQPGRLSSRFWRLLGASTEKNRSR
SLADVTASAEYDKEAADLSDEKLRKAAGLLNLDDLAESADIPQFLAIAREAAERRTGLRP
FDVQLLGALRMLAGDVIEMATGEGKTLAGAIAAAGYALAGRHVHVVTINDYLARRDAEWM
GPLLDAMGLTVGWITADSTPDERRTAYDRDVTYASVNEIGFDVLRDQLVTDVNDLVSPNP
DVALIDEADSVLVDEALVPLVLAGTTHRETPRLEIIRLVAELVGDKDADEYFATDSDNRN
VHLTEHGARKVEKALGGIDLYSEEHVGTTLTEVNVALHAHVLLQRDVHYIVRDDAVHLIN
ASRGRIAQLQRWPDGLQAAVEAKEGIETTETGEVLDTITVQALINRYATVCGMTGTALAA
GEQLRQFYQLGVSPIPPNKPNIREDEADRVYITTAAKNDGIVEHITEVHQRGQPVLVGTR
DVAESEELHERLVRRGVPAVVLNAKNDAEEARVIAEAGKYGAVTVSTQMAGRGTDIRLGG
SDEADHDRVAELGGLHVVGTGRHHTERLDNQLRGRAGRQGDPGSSVFFSSWEDDVVAANL
DHNKLPMATDENGRIVSPRTGSLLDHAQRVAEGRLLDVHANTWRYNQLIAQQRAIIVERR
NTLLRTVTAREELAELAPKRYEELSDKVSEERLETICRQIMLYHLDRGWADHLAYLADIR
ESIHLRALGRQNPLDEFHRMAVDAFASLAADAIEAAQQTFETANVLDHEPGLDLSKLARP
TSTWTYMVNDNPLSDDTLSALSLPGVFR