Protein Info for Rv1819c in Mycobacterium tuberculosis H37Rv

Annotation: Probable drug-transport transmembrane ATP-binding protein ABC transporter BacA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 639 transmembrane" amino acids 20 to 44 (25 residues), see Phobius details amino acids 65 to 87 (23 residues), see Phobius details amino acids 121 to 141 (21 residues), see Phobius details amino acids 214 to 235 (22 residues), see Phobius details amino acids 250 to 273 (24 residues), see Phobius details PF06472: ABC_membrane_2" amino acids 54 to 358 (305 residues), 266.5 bits, see alignment E=3.9e-83 PF05992: SbmA_BacA" amino acids 66 to 401 (336 residues), 90.2 bits, see alignment E=2.7e-29 PF00005: ABC_tran" amino acids 444 to 579 (136 residues), 59.1 bits, see alignment E=1.2e-19

Best Hits

Swiss-Prot: 100% identical to BACA_MYCTU: Vitamin B12 transport ATP-binding protein BacA (bacA) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K02471, putative ATP-binding cassette transporter (inferred from 100% identity to mra:MRA_1831)

Predicted SEED Role

"Drugs-transport transmembrane ATP-binding protein ABC transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (639 amino acids)

>Rv1819c Probable drug-transport transmembrane ATP-binding protein ABC transporter BacA (Mycobacterium tuberculosis H37Rv)
LGPKLFKPSIDWSRAFPDSVYWVGKAWTISAICVLAILVLLRYLTPWGRQFWRITRAYFV
GPNSVRVWLMLGVLLLSVVLAVRLNVLFSYQGNDMYTALQKAFEGIASGDGTVKRSGVRG
FWMSIGVFSVMAVLHVTRVMADIYLTQRFIIAWRVWLTHHLTQDWLDGRAYYRDLFIDET
IDNPDQRIQQDVDIFTAGAGGTPNAPSNGTASTLLFGAVQSIISVISFTAILWNLSGTLN
IFGVSIPRAMFWTVLVYVFVATVISFIIGRPLIWLSFRNEKLNAAFRYALVRLRDAAEAV
GFYRGERVEGTQLQRRFTPVIDNYRRYVRRSIAFNGWNLSVSQTIVPLPWVIQAPRLFAG
QIDFGDVGQTATSFGNIHDSLSFFRNNYDAFASFRAAIIRLHGLVDANEKGRALPAVLTR
PSDDESVELNDIEVRTPAGDRLIDPLDVRLDRGGSLVITGRSGAGKTTLLRSLAELWPYA
SGTLHRPGGENETMFLSQLPYVPLGTLRDVVCYPNSAAAIPDATLRDTLTKVALAPLCDR
LDEERDWAKVLSPGEQQRVAFARILLTKPKAVFLDESTSALDTGLEFALYQLLRSELPDC
IVISVSHRPALERLHENQLELLGGGQWRLAPVEAAPAEV