Protein Info for Rv1814 in Mycobacterium tuberculosis H37Rv

Annotation: Membrane-bound C-5 sterol desaturase Erg3 (sterol-C5-desaturase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 54 to 80 (27 residues), see Phobius details amino acids 91 to 108 (18 residues), see Phobius details amino acids 158 to 177 (20 residues), see Phobius details PF04116: FA_hydroxylase" amino acids 94 to 227 (134 residues), 92.2 bits, see alignment E=1.9e-30

Best Hits

Swiss-Prot: 100% identical to ERG3_MYCTU: C-5 sterol desaturase (erg3) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K00258, [EC: 1.3.-.-] (inferred from 100% identity to mbt:JTY_1832)

Predicted SEED Role

"Membrane-bound C-5 sterol desaturase Erg3"

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (300 amino acids)

>Rv1814 Membrane-bound C-5 sterol desaturase Erg3 (sterol-C5-desaturase) (Mycobacterium tuberculosis H37Rv)
MRDPVLFAIPCFLLLLILEWTAARKLESIETAATGQPRPASGAYLTRDSVASISMGLVSI
ATTAGWKSLALLGYAAIYAYLAPWQLSAHRWYTWVIAIVGVDLLYYSYHRIAHRVRLIWA
THQAHHSSEYFNFATALRQKWNNSGEILMWVPLPLMGLPPWMVFCSWSLNLIYQFWVHTE
RIDRLPRWFEFVFNTPSHHRVHHGMDPVYLDKNYGGILIIWDRLFGSFQPELFRPHYGLT
KRVDTFNIWKLQTREYVAIVRDWRSATRLRDRLGYVFGPPGWEPRTIDKSNAAASLVTSR