Protein Info for Rv1798 in Mycobacterium tuberculosis H37Rv

Annotation: ESX conserved component EccA5. ESX-5 type VII secretion system protein.

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 610 PF21545: T7SS_EccA1_N" amino acids 17 to 288 (272 residues), 309 bits, see alignment E=5.4e-96 TIGR03922: type VII secretion AAA-ATPase EccA" amino acids 42 to 593 (552 residues), 787.7 bits, see alignment E=3.1e-241 PF07728: AAA_5" amino acids 352 to 426 (75 residues), 28.9 bits, see alignment E=2.1e-10 PF00004: AAA" amino acids 354 to 486 (133 residues), 59.2 bits, see alignment E=1.2e-19 PF17866: AAA_lid_6" amino acids 490 to 597 (108 residues), 30.5 bits, see alignment E=7.1e-11

Best Hits

Swiss-Prot: 100% identical to ECCA5_MYCTU: ESX-5 secretion system protein EccA5 (eccA5) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 100% identity to mtb:TBMG_02198)

Predicted SEED Role

"Type VII secretion AAA-ATPase EccA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (610 amino acids)

>Rv1798 ESX conserved component EccA5. ESX-5 type VII secretion system protein. (Mycobacterium tuberculosis H37Rv)
MTRPQAAAEDARNAMVAGLLASGISVNGLQPSHNPQVAAQMFTTATRLDPKMCDAWLARL
LAGDQSIEVLAGAWAAVRTFGWETRRLGVTDLQFRPEVSDGLFLRLAITSVDSLACAYAA
VLAEAKRYQEAAELLDATDPRHPFDAELVSYVRGVLYFRTKRWPDVLAQFPEATQWRHPE
LKAAGAAMATTALASLGVFEEAFRRAQEAIEGDRVPGAANIALYTQGMCLRHVGREEEAV
ELLRRVYSRDAKFTPAREALDNPNFRLILTDPETIEARTDPWDPDSAPTRAQTEAARHAE
MAAKYLAEGDAELNAMLGMEQAKKEIKLIKSTTKVNLARAKMGLPVPVTSRHTLLLGPPG
TGKTSVARAFTKQLCGLTVLRKPLVVETSRTKLLGRYMADAEKNTEEMLEGALGGAVFFD
EMHTLHEKGYSQGDPYGNAIINTLLLYMENHRDELVVFGAGYAKAMEKMLEVNQGLRRRF
STVIEFFSYTPQELIALTQLMGRENEDVITEEESQVLLPSYTKFYMEQSYSEDGDLIRGI
DLLGNAGFVRNVVEKARDHRSFRLDDEDLDAVLASDLTEFSEDQLRRFKELTREDLAEGL
RAAVAEKKTK