Protein Info for Rv1796 in Mycobacterium tuberculosis H37Rv

Annotation: Probable proline rich membrane-anchored mycosin MycP5 (serine protease) (subtilisin-like protease) (subtilase-like) (mycosin-5)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 585 signal peptide" amino acids 1 to 40 (40 residues), see Phobius details transmembrane" amino acids 553 to 577 (25 residues), see Phobius details PF00082: Peptidase_S8" amino acids 100 to 157 (58 residues), 24.9 bits, see alignment 6.2e-10 amino acids 269 to 513 (245 residues), 80.5 bits, see alignment E=7e-27 TIGR03921: type VII secretion-associated serine protease mycosin" amino acids 266 to 582 (317 residues), 287.2 bits, see alignment E=9.1e-90

Best Hits

Swiss-Prot: 100% identical to MYCP5_MYCTU: Mycosin-5 (mycP5) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K14743, membrane-anchored mycosin MYCP [EC: 3.4.21.-] (inferred from 100% identity to mra:MRA_1809)

Predicted SEED Role

"Type VII secretion-associated serine protease mycosin"

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.-

Use Curated BLAST to search for 3.4.21.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (585 amino acids)

>Rv1796 Probable proline rich membrane-anchored mycosin MycP5 (serine protease) (subtilisin-like protease) (subtilase-like) (mycosin-5) (Mycobacterium tuberculosis H37Rv)
MQRFGTGSSRSWCGRAGTATIAAVLLASGALTGLPPAYAISPPTIDPGALPPDGPPGPLA
PMKQNAYCTEVGVLPGTDFQLQPKYMEMLNLNEAWQFGRGDGVKVAVIDTGVTPHPRLPR
LIPGGDYVMAGGDGLSDCDAHGTLVASMIAAVPANGAVPLPSVPRRPVTIPTTETPPPPQ
TVTLSPVPPQTVTVIPAPPPEEGVPPGAPVPGPEPPPAPGPQPPAVDRGGGTVTVPSYSG
GRKIAPIDNPRNPHPSAPSPALGPPPDAFSGIAPGVEIISIRQSSQAFGLKDPYTGDEDP
QTAQKIDNVETMARAIVHAANMGASVINISDVMCMSARNVIDQRALGAAVHYAAVDKDAV
IVAAAGDGSKKDCKQNPIFDPLQPDDPRAWNAVTTVVTPSWFHDYVLTVGAVDANGQPLS
KMSIAGPWVSISAPGTDVVGLSPRDDGLINAIDGPDNSLLVPAGTSFSAAIVSGVAALVR
AKFPELSAYQIINRLIHTARPPARGVDNQVGYGVVDPVAALTWDVPKGPAEPPKQLSAPL
VVPQPPAPRDMVPIWVAAGGLAGALLIGGAVFGTATLMRRSRKQQ