Protein Info for Rv1767 in Mycobacterium tuberculosis H37Rv

Annotation: Conserved protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 119 PF02627: CMD" amino acids 26 to 106 (81 residues), 80.5 bits, see alignment E=3.7e-27 TIGR00778: alkylhydroperoxidase AhpD family core domain" amino acids 43 to 92 (50 residues), 60.7 bits, see alignment E=3.5e-21

Best Hits

Swiss-Prot: 39% identical to Y4147_CUPNH: Uncharacterized protein H16_B0147 (H16_B0147) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: None (inferred from 100% identity to mbt:JTY_1784)

Predicted SEED Role

"Possible carboxymuconolactone decarboxylase family protein (EC 4.1.1.44)" (EC 4.1.1.44)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.44

Use Curated BLAST to search for 4.1.1.44

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (119 amino acids)

>Rv1767 Conserved protein (Mycobacterium tuberculosis H37Rv)
MSDQPRHHQVLDDLLPQHRALRHQIPQVYQRFVALGDAALTDGALSRKVKELVALAIAVV
QGCDGCVASHAQAAVRAGATAQEAAEAIGVTILMHGGPATIHGARAYAAFCEFADTTPS