Protein Info for Rv1739c in Mycobacterium tuberculosis H37Rv

Annotation: Probable sulphate-transport transmembrane protein ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 560 transmembrane" amino acids 28 to 48 (21 residues), see Phobius details amino acids 53 to 71 (19 residues), see Phobius details amino acids 79 to 98 (20 residues), see Phobius details amino acids 104 to 127 (24 residues), see Phobius details amino acids 139 to 161 (23 residues), see Phobius details amino acids 182 to 201 (20 residues), see Phobius details amino acids 211 to 234 (24 residues), see Phobius details amino acids 256 to 278 (23 residues), see Phobius details amino acids 295 to 309 (15 residues), see Phobius details amino acids 333 to 367 (35 residues), see Phobius details amino acids 386 to 414 (29 residues), see Phobius details TIGR00815: sulfate permease" amino acids 14 to 553 (540 residues), 441.3 bits, see alignment E=2.5e-136 PF00916: Sulfate_transp" amino acids 25 to 392 (368 residues), 373.4 bits, see alignment E=1.1e-115 PF01740: STAS" amino acids 443 to 553 (111 residues), 56.2 bits, see alignment E=2.7e-19

Best Hits

Swiss-Prot: 100% identical to Y1739_MYCTU: Probable sulfate transporter Rv1739c (Rv1739c) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 100% identity to mtb:TBMG_02256)

Predicted SEED Role

"Sulfate permease" in subsystem Cysteine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (560 amino acids)

>Rv1739c Probable sulphate-transport transmembrane protein ABC transporter (Mycobacterium tuberculosis H37Rv)
MIPTMTSAGWAPGVVQFREYQRRWLRGDVLAGLTVAAYLIPQAMAYATVAGLPPAAGLWA
SIAPLAIYALLGSSRQLSIGPESATALMTAAVLAPMAAGDLRRYAVLAATLGLLVGLICL
LAGTARLGFLASLRSRPVLVGYMAGIALVMISSQLGTITGTSVEGNEFFSEVHSFATSVT
RVHWPTFVLAMSVLALLTMLTRWAPRAPGPIIAVLAATMLVAVMSLDAKGIAIVGRIPSG
LPTPGVPPVSVEDLRALIIPAAGIAIVTFTDGVLTARAFAARRGQEVNANAELRAVGACN
IAAGLTHGFPVSSSSSRTALADVVGGRTQLYSLIALGLVVIVMVFASGLLAMFPIAALGA
LVVYAALRLIDLSEFRRLARFRRSELMLALATTAAVLGLGVFYGVLAAVALSILELLRRV
AHPHDSVLGFVPGIAGMHDIDDYPQAKRVPGLVVYRYDAPLCFANAEDFRRRALTVVDQD
PGQVEWFVLNAESNVEVDLTALDALDQLRTELLRRGIVFAMARVKQDLRESLRAASLLDK
IGEDHIFMTLPTAVQAFRRR