Protein Info for Rv1737c in Mycobacterium tuberculosis H37Rv

Annotation: Possible nitrate/nitrite transporter NarK2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 395 transmembrane" amino acids 7 to 25 (19 residues), see Phobius details amino acids 43 to 60 (18 residues), see Phobius details amino acids 72 to 92 (21 residues), see Phobius details amino acids 98 to 120 (23 residues), see Phobius details amino acids 132 to 151 (20 residues), see Phobius details amino acids 157 to 182 (26 residues), see Phobius details amino acids 207 to 229 (23 residues), see Phobius details amino acids 244 to 262 (19 residues), see Phobius details amino acids 273 to 291 (19 residues), see Phobius details amino acids 297 to 321 (25 residues), see Phobius details amino acids 328 to 348 (21 residues), see Phobius details amino acids 363 to 385 (23 residues), see Phobius details PF07690: MFS_1" amino acids 14 to 345 (332 residues), 125.9 bits, see alignment E=2.7e-40 amino acids 245 to 391 (147 residues), 50.4 bits, see alignment E=2.5e-17

Best Hits

Swiss-Prot: 100% identical to NARK2_MYCTU: Probable nitrate/nitrite transporter NarK2 (narK2) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K02575, MFS transporter, NNP family, nitrate/nitrite transporter (inferred from 100% identity to mbo:Mb1766c)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (395 amino acids)

>Rv1737c Possible nitrate/nitrite transporter NarK2 (Mycobacterium tuberculosis H37Rv)
MRGQAANLVLATWISVVNFWAWNLIGPLSTSYARDMSLSSAEASLLVATPILVGALGRIV
TGPLTDRFGGRAMLIAVTLASILPVLAVGVAATMGSYALLVFFGLFLGVAGTIFAVGIPF
ANNWYQPARRGFSTGVFGMGMVGTALSAFFTPRFVRWFGLFTTHAIVAAALASTAVVAMV
VLRDAPYFRPNADPVLPRLKAAARLPVTWEMSFLYAIVFGGFVAFSNYLPTYITTIYGFS
TVDAGARTAGFALAAVLARPVGGWLSDRIAPRHVVLASLAGTALLAFAAALQPPPEVWSA
ATFITLAVCLGVGTGGVFAWVARRAPAASVGSVTGIVAAAGGLGGYFPPLVMGATYDPVD
NDYTVGLLLLVATALVACTYTALHAREPVSEEASR