Protein Info for Rv1736c in Mycobacterium tuberculosis H37Rv

Annotation: Probable nitrate reductase NarX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 652 transmembrane" amino acids 420 to 439 (20 residues), see Phobius details amino acids 460 to 485 (26 residues), see Phobius details amino acids 501 to 524 (24 residues), see Phobius details amino acids 544 to 565 (22 residues), see Phobius details amino acids 597 to 616 (20 residues), see Phobius details PF00384: Molybdopterin" amino acids 118 to 245 (128 residues), 55.4 bits, see alignment E=8.4e-19 TIGR00684: nitrate reductase molybdenum cofactor assembly chaperone" amino acids 263 to 409 (147 residues), 139.9 bits, see alignment E=6.9e-45 PF02613: Nitrate_red_del" amino acids 291 to 407 (117 residues), 41.8 bits, see alignment E=1.6e-14 TIGR00351: respiratory nitrate reductase, gamma subunit" amino acids 416 to 639 (224 residues), 192 bits, see alignment E=1.3e-60 PF02665: Nitrate_red_gam" amino acids 419 to 639 (221 residues), 293.7 bits, see alignment E=1.3e-91

Best Hits

Swiss-Prot: 100% identical to NARX_MYCTO: Nitrate reductase-like protein NarX (narX) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K00369, nitrate reductase [EC: 1.7.99.4] (inferred from 100% identity to mtu:Rv1736c)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.7.99.4

Use Curated BLAST to search for 1.7.99.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (652 amino acids)

>Rv1736c Probable nitrate reductase NarX (Mycobacterium tuberculosis H37Rv)
VTVTPRTGSRIEELLARSGRFFIPGEISADLRTVTRRGGRDGDVFYRDRWSHDKVVRSTH
GVNCTGSCSWKIYVKDDIITWETQETDYPSVGPDRPEYEPRGCPRGAAFSWYTYSPTRVR
HPYARGVLVEMYREAKARLGDPVAAWADIQADPRRRRRYQRARGKGGLVRVSWAEATEMI
AAAHVHTISTYGPDRVAGFSPIPAMSMVSHAAGSRFVELIGGVMTSFYDWYADLPVASPQ
VFGDQTDVPESGDWWDVVWQCASVLLTYPNSRQLGTAEELLAHIDGPAADLLGRTVSELR
RADPLTAATRYVDTFDLRGRATLYLTYWTAGDTRNRGREMLAFAQTYRSTDVAPPRGETP
DFLPVVLEFAATVDPEAGRRLLSGYRVPIAALCNALTEAALPYAHTVAAVCRTGDMMGEL
FWTVVPYVTMTIVAVGSWWRYRYDKFGWTTRSSQLYESRLLRIASPMFHFGILVVIVGHG
IGLVIPQSWTQAAGLSEGAYHVQAVVLGSIAGITTLAGVTLLIYRRRTRGPVFMATTVND
KVMYLVLVAAIVAGLGATALGSGVVGEAYNYRETVSVWFRSVWVLQPRGDLMAEAPLYYQ
IHVLIGLALFALWPFTRLVHAFSAPIGYLFRPYIIYRSREELVLTRPRRRGW