Protein Info for Rv1735c in Mycobacterium tuberculosis H37Rv

Annotation: Hypothetical membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 165 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 27 to 51 (25 residues), see Phobius details amino acids 67 to 86 (20 residues), see Phobius details amino acids 104 to 123 (20 residues), see Phobius details PF03595: SLAC1" amino acids 1 to 118 (118 residues), 38.8 bits, see alignment E=3.2e-14

Best Hits

Swiss-Prot: 100% identical to Y1735_MYCTO: Uncharacterized membrane protein MT1776 (MT1776) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: None (inferred from 100% identity to mtu:Rv1735c)

Predicted SEED Role

"C4-dicarboxylate transporter/malic acid transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (165 amino acids)

>Rv1735c Hypothetical membrane protein (Mycobacterium tuberculosis H37Rv)
MGATAITVLAGAHIVEMADAPMAIVTSGLVAGASVVFWAFGPWLIPPLVAASIWKHVVHR
VPLRYEATLWSVVFPLGMYGVGAYRLGLAAHLPIVESIGEFEGWVALAVWTITFVAMLHH
LAATIGRSGRSSHAIGAADDTHAIICRPPRSFDHQVRAFRRNQPM