Protein Info for Rv1704c in Mycobacterium tuberculosis H37Rv

Annotation: Probable D-serine/alanine/glycine transporter protein CycA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 556 transmembrane" amino acids 26 to 43 (18 residues), see Phobius details amino acids 50 to 73 (24 residues), see Phobius details amino acids 99 to 122 (24 residues), see Phobius details amino acids 131 to 151 (21 residues), see Phobius details amino acids 161 to 183 (23 residues), see Phobius details amino acids 206 to 229 (24 residues), see Phobius details amino acids 250 to 270 (21 residues), see Phobius details amino acids 283 to 307 (25 residues), see Phobius details amino acids 343 to 362 (20 residues), see Phobius details amino acids 368 to 395 (28 residues), see Phobius details amino acids 407 to 431 (25 residues), see Phobius details amino acids 438 to 457 (20 residues), see Phobius details PF00324: AA_permease" amino acids 25 to 438 (414 residues), 353.4 bits, see alignment E=2e-109 PF13520: AA_permease_2" amino acids 29 to 451 (423 residues), 135.3 bits, see alignment E=2.9e-43

Best Hits

Swiss-Prot: 59% identical to CYCA_ECO57: D-serine/D-alanine/glycine transporter (cycA) from Escherichia coli O157:H7

KEGG orthology group: K11737, D-serine/D-alanine/glycine transporter (inferred from 100% identity to mtu:Rv1704c)

MetaCyc: 59% identical to D-serine/alanine/glycine:H+symporter (Escherichia coli K-12 substr. MG1655)
RXN0-5130; RXN0-5201; RXN0-5202; RXN0-5203; TRANS-RXN-62A; TRANS-RXN-62B

Predicted SEED Role

"D-serine/D-alanine/glycine transporter" in subsystem Glycine and Serine Utilization or Pyruvate Alanine Serine Interconversions

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (556 amino acids)

>Rv1704c Probable D-serine/alanine/glycine transporter protein CycA (Mycobacterium tuberculosis H37Rv)
MPDDIAAADPTDTQPHLRRDLANRHIQLIAIGGAIGTGLFMGSGRTISLAGPAVMVVYGI
IGFFVFFVLRAMGELLLSNLNYKSFVDFAADLRGPAAGFFVGWSYWFAWVVTGIADLVAI
TGYARFWWPGLPIWVPALVTVALILAVNLFSVRHFGELEFWFALIKVAAIVCLIAVGAIL
VATNFVSPHGVHATIENLWNDNGFFPTGFLGVVSGFQIAFFAYIGVELVGTAAAETADPR
RTLPRAINAVPLRVAVFYIGALLAILAVVPWRQFASGESPFVTMFSLAGLAAAASVVNFV
VVTAAASSANSGFFSTGRMLFGLADEGHAPAAFHQLNRGGVPAPALLLTAPLLLTSIPLL
YAGRSVIGAFTLVTTVSSLLFMFVWAMIIISYLVYRRRHPQRHTDSVYKMPGGVVMCWAV
LVFFAFVIWTLTTETETATALAWFPLWFVLLAVGWLVTQRRQSRRSFGFHCQVVGVRQQL
GRGMARLAMKIHARPKLRSAVVVEPVSAGEPGARRSAKSVRKLASDDSQSAHCPVAVVGL
ADGGRDPQYHHDGPDR