Protein Info for Rv1695 in Mycobacterium tuberculosis H37Rv

Annotation: Inorganic polyphosphate/ATP-NAD kinase PpnK (poly(P)/ATP NAD kinase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 307 PF01513: NAD_kinase" amino acids 7 to 133 (127 residues), 108.5 bits, see alignment E=3.2e-35 PF20143: NAD_kinase_C" amino acids 158 to 283 (126 residues), 132.5 bits, see alignment E=7.4e-43

Best Hits

Swiss-Prot: 100% identical to NADK_MYCTU: NAD kinase (ppnK) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K00858, NAD+ kinase [EC: 2.7.1.23] (inferred from 100% identity to mtb:TBMG_02301)

Predicted SEED Role

"NAD kinase (EC 2.7.1.23)" in subsystem NAD and NADP cofactor biosynthesis global (EC 2.7.1.23)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.23

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (307 amino acids)

>Rv1695 Inorganic polyphosphate/ATP-NAD kinase PpnK (poly(P)/ATP NAD kinase) (Mycobacterium tuberculosis H37Rv)
VTAHRSVLLVVHTGRDEATETARRVEKVLGDNKIALRVLSAEAVDRGSLHLAPDDMRAMG
VEIEVVDADQHAADGCELVLVLGGDGTFLRAAELARNASIPVLGVNLGRIGFLAEAEAEA
IDAVLEHVVAQDYRVEDRLTLDVVVRQGGRIVNRGWALNEVSLEKGPRLGVLGVVVEIDG
RPVSAFGCDGVLVSTPTGSTAYAFSAGGPVLWPDLEAILVVPNNAHALFGRPMVTSPEAT
IAIEIEADGHDALVFCDGRREMLIPAGSRLEVTRCVTSVKWARLDSAPFTDRLVRKFRLP
VTGWRGK