Protein Info for Rv1686c in Mycobacterium tuberculosis H37Rv

Annotation: Probable conserved integral membrane protein ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 226 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 33 to 54 (22 residues), see Phobius details amino acids 75 to 102 (28 residues), see Phobius details amino acids 112 to 135 (24 residues), see Phobius details amino acids 145 to 165 (21 residues), see Phobius details amino acids 203 to 221 (19 residues), see Phobius details TIGR00025: ABC transporter efflux protein, DrrB family" amino acids 2 to 225 (224 residues), 284.7 bits, see alignment E=2.9e-89 PF01061: ABC2_membrane" amino acids 4 to 188 (185 residues), 102.5 bits, see alignment E=3.6e-33 PF12698: ABC2_membrane_3" amino acids 28 to 218 (191 residues), 71.6 bits, see alignment E=9.8e-24 PF12679: ABC2_membrane_2" amino acids 46 to 224 (179 residues), 27.7 bits, see alignment E=2.4e-10

Best Hits

KEGG orthology group: K01992, ABC-2 type transport system permease protein (inferred from 100% identity to mbo:Mb1712c)

Predicted SEED Role

"ABC drug efflux pump, inner membrane subunit, DrrB family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (226 amino acids)

>Rv1686c Probable conserved integral membrane protein ABC transporter (Mycobacterium tuberculosis H37Rv)
MILLVPILIITLMYFMFENVPHRPGTPSGFNTACLVLLGLFPLFVMFVITAITMQRERAS
GTLERILTTPLRRLDLLAGYGTAFSIAAAAQATLACIVAFWFLGFDTAGSPVWVFAIAIV
NAVLGVGLGLLCSAFARTEFQAVQFIPLVMVPQLLLAGIIVPRALMPTWLEWISNVMPAS
YALEALQQVGAHPELTGIAVRDVVVVLSFAVASLCLAAVTLRRRTS