Protein Info for Rv1678 in Mycobacterium tuberculosis H37Rv

Annotation: Probable integral membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 transmembrane" amino acids 21 to 40 (20 residues), see Phobius details amino acids 81 to 104 (24 residues), see Phobius details amino acids 111 to 128 (18 residues), see Phobius details amino acids 135 to 158 (24 residues), see Phobius details amino acids 178 to 198 (21 residues), see Phobius details amino acids 218 to 237 (20 residues), see Phobius details amino acids 244 to 262 (19 residues), see Phobius details amino acids 268 to 289 (22 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 100% identity to mra:MRA_1689)

Predicted SEED Role

"FIG00824646: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (300 amino acids)

>Rv1678 Probable integral membrane protein (Mycobacterium tuberculosis H37Rv)
MARVRRGTELLLSPQSPPATGGLIVLTGLRLLAGLIWLYNVVWKVPPDFGERGRRDLYHF
THLAVEHPVFTPFSWVIEHAVLPYFTAFGWGVLFAESALAVLLLTGTAVRLAALIGIGQS
VAIGLSVAESPGEWPWAYAMLLGIHVVLLFTCSTRYAAVDAVRAAATGSAARTAAQRLLA
GWGIVLGLIGLVAVWRGLGDDRPAYVGIRALEFSLGEYNLRGALALIAIALAMLAAAKRG
WRTVALVAAVVAVAAAAAIYLQVGRTAVWLGGTNTTAAVFVCAAVVSLATEFRIGRVEGA