Protein Info for Rv1672c in Mycobacterium tuberculosis H37Rv

Annotation: Probable conserved integral membrane transport protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 443 transmembrane" amino acids 21 to 44 (24 residues), see Phobius details amino acids 53 to 74 (22 residues), see Phobius details amino acids 86 to 105 (20 residues), see Phobius details amino acids 111 to 136 (26 residues), see Phobius details amino acids 146 to 169 (24 residues), see Phobius details amino acids 178 to 196 (19 residues), see Phobius details amino acids 240 to 261 (22 residues), see Phobius details amino acids 273 to 295 (23 residues), see Phobius details amino acids 307 to 326 (20 residues), see Phobius details amino acids 332 to 353 (22 residues), see Phobius details amino acids 365 to 385 (21 residues), see Phobius details amino acids 397 to 418 (22 residues), see Phobius details PF07690: MFS_1" amino acids 24 to 384 (361 residues), 124.2 bits, see alignment E=6e-40

Best Hits

KEGG orthology group: None (inferred from 100% identity to mbo:Mb1699c)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (443 amino acids)

>Rv1672c Probable conserved integral membrane transport protein (Mycobacterium tuberculosis H37Rv)
VATIAASPTHNALGKAARRLLPLLFVLYVINFVDRANISVAALAMNADLRLSATAYGTAA
GVFFLGYVLFQVPANAALARFGAGRTLTAVVLAWGVCSAATALVTSAHTLYLARFALGVA
EGGFFPGVIAYLTVWFPCAQRARAVATFLLAIPVANTVGLPLSGLIVGHVHMAGLPGWRA
MFVIEALPALLLAPLLRRLLPDNPQRASWLTPEERAELSARLTEDTPAPTGRSSGAGWDL
VLFAVVYGGLYFALYALQFFLPQLVASLAHGTATLTAATLAALPYGVAALAMLAWSHRSI
DRSGAQAGHITLPTTAAGSAALGAALSPMSPIVTLSWLTIAVAGILAAMPAFWSRCTAAL
AGPRVAVAIATVNAVASLASFAGPYATGHLKDATGTYHLALLTVAAVLAAAAACSLLLRH
AGRTVCANDSEIMLHPSPATPFV