Protein Info for Rv1665 in Mycobacterium tuberculosis H37Rv

Annotation: Chalcone synthase Pks11

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 353 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 332 to 350 (19 residues), see Phobius details PF00195: Chal_sti_synt_N" amino acids 9 to 197 (189 residues), 76.9 bits, see alignment E=3.3e-25 PF08392: FAE1_CUT1_RppA" amino acids 87 to 199 (113 residues), 53.9 bits, see alignment E=3.6e-18 PF02797: Chal_sti_synt_C" amino acids 219 to 351 (133 residues), 61 bits, see alignment E=2.8e-20 PF08541: ACP_syn_III_C" amino acids 261 to 352 (92 residues), 40.5 bits, see alignment E=5.2e-14

Best Hits

Swiss-Prot: 100% identical to PKS11_MYCTO: Alpha-pyrone synthesis polyketide synthase-like Pks11 (pks11) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K00660, chalcone synthase [EC: 2.3.1.74] (inferred from 100% identity to mtf:TBFG_11683)

Predicted SEED Role

"Chalcone synthase (EC 2.3.1.74)" in subsystem Flavanone biosynthesis (EC 2.3.1.74)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.74

Use Curated BLAST to search for 2.3.1.74

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (353 amino acids)

>Rv1665 Chalcone synthase Pks11 (Mycobacterium tuberculosis H37Rv)
MSVIAGVFGALPPHRYSQSEITDSFVEFPGLKEHEEIIRRLHAAAKVNGRHLVLPLQQYP
SLTDFGDANEIFIEKAVDLGVEALLGALDDANLRPSDIDMIATATVTGVAVPSLDARIAG
RLGLRPDVRRMPLFGLGCVAGAAGVARLRDYLRGAPDDVAVLVSVELCSLTYPAVKPTVS
SLVGTALFGDGAAAVVAVGDRRAEQVRAGGPDILDSRSSLYPDSLHIMGWDVGSHGLRLR
LSPDLTNLIERYLANDVTTFLDAHRLTKDDIGAWVSHPGGPKVIDAVATSLALPPEALEL
TWRSLGEIGNLSSASILHILRDTIEKRPPSGSAGLMLAMGPGFCTELVLLRWR