Protein Info for Rv1660 in Mycobacterium tuberculosis H37Rv

Annotation: Chalcone synthase Pks10

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 100% identical to PKS10_MYCTU: Polyketide synthase-like Pks10 (pks10) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K00660, chalcone synthase [EC: 2.3.1.74] (inferred from 100% identity to mtc:MT1698)

MetaCyc: 52% identical to 1,3,6,8-tetrahydroxynaphthalene synthase (Streptomyces peucetius caesius ATCC 27952)
RXN-9931 [EC: 2.3.1.233]

Predicted SEED Role

"Chalcone synthase (EC 2.3.1.74)" in subsystem Flavanone biosynthesis (EC 2.3.1.74)

MetaCyc Pathways

aromatic polyketides biosynthesis (1/2 steps found)
phloridzin biosynthesis (1/3 steps found)
naringenin biosynthesis (engineered) (1/4 steps found)
xanthohumol biosynthesis (1/4 steps found)
flaviolin dimer and mompain biosynthesis (1/5 steps found)
flavonoid biosynthesis (1/5 steps found)
furaquinocin biosynthesis (1/8 steps found)
flavonoid biosynthesis (in equisetum) (1/10 steps found)
flavonoid di-C-glucosylation (4/15 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.74

Use Curated BLAST to search for 2.3.1.233 or 2.3.1.74

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (353 amino acids)

>Rv1660 Chalcone synthase Pks10 (Mycobacterium tuberculosis H37Rv)
VSVIAGVFGALPPYRYSQRELTDSFVSIPDFEGYEDIVRQLHASAKVNSRHLVLPLEKYP
KLTDFGEANKIFIEKAVDLGVQALAGALDESGLRPEDLDVLITATVTGLAVPSLDARIAG
RLGLRADVRRVPLFGLGCVAGAAGVARLHDYLRGAPDGVAALVSVELCSLTYPGYKPTLP
GLVGSALFADGAAAVVAAGVKRAQDIGADGPDILDSRSHLYPDSLRTMGYDVGSAGFELV
LSRDLAAVVEQYLGNDVTTFLASHGLSTTDVGAWVTHPGGPKIINAITETLDLSPQALEL
TWRSLGEIGNLSSASVLHVLRDTIAKPPPSGSPGLMIAMGPGFCSELVLLRWH