Protein Info for Rv1658 in Mycobacterium tuberculosis H37Rv

Annotation: Probable argininosuccinate synthase ArgG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00032: argininosuccinate synthase
  • amino acids 4 to 393 (390 residues), 468.2 bits, E=1.3e-144
• PF00764: Arginosuc_synth
  • amino acids 4 to 165 (162 residues), 252.8 bits, E=1.5e-79
• PF20979: Arginosuc_syn_C
  • amino acids 174 to 391 (218 residues), 337.8 bits, E=2.9e-105

Best Hits

Swiss-Prot: 100% identical to ASSY_MYCBT: Argininosuccinate synthase (argG) from Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)

KEGG orthology group: K01940, argininosuccinate synthase [EC: 6.3.4.5] (inferred from 100% identity to mbb:BCG_1697)

Predicted SEED Role

"Argininosuccinate synthase (EC 6.3.4.5)" in subsystem Arginine Biosynthesis extended (EC 6.3.4.5)

MetaCyc Pathways

• L-arginine biosynthesis II (acetyl cycle) (10/10 steps found)
• L-arginine biosynthesis I (via L-ornithine) (8/9 steps found)
• L-arginine biosynthesis III (via N-acetyl-L-citrulline) (7/9 steps found)
• nitric oxide biosynthesis II (mammals) (2/3 steps found)
• urea cycle (3/5 steps found)
• superpathway of L-citrulline metabolism (8/12 steps found)
• canavanine biosynthesis (2/4 steps found)
• superpathway of arginine and polyamine biosynthesis (11/17 steps found)
• L-arginine biosynthesis IV (archaea) (4/9 steps found)

KEGG Metabolic Maps

• Alanine and aspartate metabolism
• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.5

Protein Sequence (398 amino acids)

>Rv1658 Probable argininosuccinate synthase ArgG (Mycobacterium tuberculosis H37Rv)
MSERVILAYSGGLDTSVAISWIGKETGREVVAVAIDLGQGGEHMDVIRQRALDCGAVEAV
VVDARDEFAEGYCLPTVLNNALYMDRYPLVSAISRPLIVKHLVAAAREHGGGIVAHGCTG
KGNDQVRFEVGFASLAPDLEVLAPVRDYAWTREKAIAFAEENAIPINVTKRSPFSIDQNV
WGRAVETGFLEHLWNAPTKDIYAYTEDPTINWGVPDEVIVGFERGVPVSVDGKPVSMLAA
IEELNRRAGAQGVGRLDVVEDRLVGIKSREIYEAPGAMVLITAHTELEHVTLERELGRFK
RQTDQRWAELVYDGLWYSPLKAALEAFVAKTQEHVSGEVRLVLHGGHIAVNGRRSAESLY
DFNLATYDEGDSFDQSAARGFVYVHGLSSKLAARRDLR