Protein Info for Rv1657 in Mycobacterium tuberculosis H37Rv

Annotation: Probable arginine repressor ArgR (AHRC)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01316: Arg_repressor
  • amino acids 16 to 85 (70 residues), 89.5 bits, E=9.4e-30
• TIGR01529: arginine repressor
  • amino acids 20 to 169 (150 residues), 171.8 bits, E=4.7e-55
• PF02863: Arg_repressor_C
  • amino acids 102 to 167 (66 residues), 83.8 bits, E=5.9e-28

Best Hits

Swiss-Prot: 100% identical to ARGR_MYCBP: Arginine repressor (argR) from Mycobacterium bovis (strain BCG / Pasteur 1173P2)

KEGG orthology group: K03402, transcriptional regulator of arginine metabolism (inferred from 100% identity to mtc:MT1695)

Predicted SEED Role

"Arginine pathway regulatory protein ArgR, repressor of arg regulon" in subsystem Arginine Biosynthesis extended or Arginine Deiminase Pathway or Arginine and Ornithine Degradation

Protein Sequence (170 amino acids)

>Rv1657 Probable arginine repressor ArgR (AHRC) (Mycobacterium tuberculosis H37Rv)
MSRAKAAPVAGPEVAANRAGRQARIVAILSSAQVRSQNELAALLAAEGIEVTQATLSRDL
EELGAVKLRGADGGTGIYVVPEDGSPVRGVSGGTDRMARLLGELLVSTDDSGNLAVLRTP
PGAAHYLASAIDRAALPQVVGTIAGDDTILVVAREPTTGAQLAGMFENLR