Protein Info for Rv1652 in Mycobacterium tuberculosis H37Rv

Annotation: Probable N-acetyl-gamma-glutamyl-phoshate reductase ArgC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 352 PF01118: Semialdhyde_dh" amino acids 11 to 140 (130 residues), 67.9 bits, see alignment E=1.7e-22 TIGR01850: N-acetyl-gamma-glutamyl-phosphate reductase" amino acids 11 to 352 (342 residues), 379.8 bits, see alignment E=6.6e-118 PF22698: Semialdhyde_dhC_1" amino acids 158 to 320 (163 residues), 173 bits, see alignment E=7.6e-55 PF02774: Semialdhyde_dhC" amino acids 167 to 323 (157 residues), 103.2 bits, see alignment E=3e-33

Best Hits

Swiss-Prot: 100% identical to ARGC_MYCBO: N-acetyl-gamma-glutamyl-phosphate reductase (argC) from Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

KEGG orthology group: K00145, N-acetyl-gamma-glutamyl-phosphate/N-acetyl-gamma-aminoadipyl-phosphate reductase [EC: 1.2.1.- 1.2.1.38] (inferred from 100% identity to mtu:Rv1652)

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.-

Use Curated BLAST to search for 1.2.1.- or 1.2.1.38

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (352 amino acids)

>Rv1652 Probable N-acetyl-gamma-glutamyl-phoshate reductase ArgC (Mycobacterium tuberculosis H37Rv)
MQNRQVANATKVAVAGASGYAGGEILRLLLGHPAYADGRLRIGALTAATSAGSTLGEHHP
HLTPLAHRVVEPTEAAVLGGHDAVFLALPHGHSAVLAQQLSPETLIIDCGADFRLTDAAV
WERFYGSSHAGSWPYGLPELPGARDQLRGTRRIAVPGCYPTAALLALFPALAADLIEPAV
TVVAVSGTSGAGRAATTDLLGAEVIGSARAYNIAGVHRHTPEIAQGLRAVTDRDVSVSFT
PVLIPASRGILATCTARTRSPLSQLRAAYEKAYHAEPFIYLMPEGQLPRTGAVIGSNAAH
IAVAVDEDAQTFVAIAAIDNLVKGTAGAAVQSMNLALGWPETDGLSVVGVAP