Protein Info for Rv1652 in Mycobacterium tuberculosis H37Rv

Annotation: Probable N-acetyl-gamma-glutamyl-phoshate reductase ArgC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01850: N-acetyl-gamma-glutamyl-phosphate reductase
  • amino acids 11 to 352 (342 residues), 379.8 bits, E=6.6e-118
• PF01118: Semialdhyde_dh
  • amino acids 11 to 140 (130 residues), 67.9 bits, E=1.7e-22
• PF22698: Semialdhyde_dhC_1
  • amino acids 158 to 320 (163 residues), 173 bits, E=7.6e-55
• PF02774: Semialdhyde_dhC
  • amino acids 167 to 323 (157 residues), 103.2 bits, E=3e-33

Best Hits

Swiss-Prot: 100% identical to ARGC_MYCBO: N-acetyl-gamma-glutamyl-phosphate reductase (argC) from Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

KEGG orthology group: K00145, N-acetyl-gamma-glutamyl-phosphate/N-acetyl-gamma-aminoadipyl-phosphate reductase [EC: 1.2.1.- 1.2.1.38] (inferred from 100% identity to mtu:Rv1652)

Predicted SEED Role

No annotation

MetaCyc Pathways

• L-arginine biosynthesis II (acetyl cycle) (10/10 steps found)
• L-arginine biosynthesis I (via L-ornithine) (8/9 steps found)
• L-arginine biosynthesis III (via N-acetyl-L-citrulline) (7/9 steps found)
• L-ornithine biosynthesis I (4/5 steps found)
• superpathway of arginine and polyamine biosynthesis (11/17 steps found)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Arginine and proline metabolism
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Geraniol degradation
• Limonene and pinene degradation
• Lysine biosynthesis
• Naphthalene and anthracene degradation
• Tryptophan metabolism
• Urea cycle and metabolism of amino groups

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.-

Use Curated BLAST to search for 1.2.1.- or 1.2.1.38

Protein Sequence (352 amino acids)

>Rv1652 Probable N-acetyl-gamma-glutamyl-phoshate reductase ArgC (Mycobacterium tuberculosis H37Rv)
MQNRQVANATKVAVAGASGYAGGEILRLLLGHPAYADGRLRIGALTAATSAGSTLGEHHP
HLTPLAHRVVEPTEAAVLGGHDAVFLALPHGHSAVLAQQLSPETLIIDCGADFRLTDAAV
WERFYGSSHAGSWPYGLPELPGARDQLRGTRRIAVPGCYPTAALLALFPALAADLIEPAV
TVVAVSGTSGAGRAATTDLLGAEVIGSARAYNIAGVHRHTPEIAQGLRAVTDRDVSVSFT
PVLIPASRGILATCTARTRSPLSQLRAAYEKAYHAEPFIYLMPEGQLPRTGAVIGSNAAH
IAVAVDEDAQTFVAIAAIDNLVKGTAGAAVQSMNLALGWPETDGLSVVGVAP