Protein Info for Rv1641 in Mycobacterium tuberculosis H37Rv

Annotation: Probable initiation factor if-3 InfC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 201 PF05198: IF3_N" amino acids 7 to 75 (69 residues), 112.7 bits, see alignment E=7.3e-37 TIGR00168: translation initiation factor IF-3" amino acids 7 to 168 (162 residues), 200.7 bits, see alignment E=6.2e-64 PF00707: IF3_C" amino acids 84 to 168 (85 residues), 110.9 bits, see alignment E=2.2e-36

Best Hits

Swiss-Prot: 100% identical to IF3_MYCTU: Translation initiation factor IF-3 (infC) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K02520, translation initiation factor IF-3 (inferred from 99% identity to mbt:JTY_1655)

Predicted SEED Role

"Translation initiation factor 3"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (201 amino acids)

>Rv1641 Probable initiation factor if-3 InfC (Mycobacterium tuberculosis H37Rv)
ISTETRVNERIRVPEVRLIGPGGEQVGIVRIEDALRVAADADLDLVEVAPNARPPVCKIM
DYGKYKYEAAQKARESRRNQQQTVVKEQKLRPKIDDHDYETKKGHVVRFLEAGSKVKVTI
MFRGREQSRPELGYRLLQRLGADVADYGFIETSAKQDGRNMTMVLAPHRGAKTRARARHP
GEPAGGPPPKPTAGDSKAAPN