Protein Info for Rv1634 in Mycobacterium tuberculosis H37Rv

Annotation: Possible drug efflux membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 471 transmembrane" amino acids 18 to 43 (26 residues), see Phobius details amino acids 55 to 76 (22 residues), see Phobius details amino acids 86 to 104 (19 residues), see Phobius details amino acids 115 to 132 (18 residues), see Phobius details amino acids 145 to 167 (23 residues), see Phobius details amino acids 174 to 195 (22 residues), see Phobius details amino acids 214 to 234 (21 residues), see Phobius details amino acids 241 to 262 (22 residues), see Phobius details amino acids 278 to 298 (21 residues), see Phobius details amino acids 306 to 325 (20 residues), see Phobius details amino acids 337 to 358 (22 residues), see Phobius details amino acids 366 to 387 (22 residues), see Phobius details amino acids 407 to 431 (25 residues), see Phobius details amino acids 443 to 462 (20 residues), see Phobius details PF07690: MFS_1" amino acids 26 to 423 (398 residues), 107.6 bits, see alignment E=3.2e-35

Best Hits

Swiss-Prot: 100% identical to Y1634_MYCTO: Probable multidrug-efflux transporter MT1670 (MT1670) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: None (inferred from 99% identity to mbb:BCG_1672)

Predicted SEED Role

"Drug efflux membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (471 amino acids)

>Rv1634 Possible drug efflux membrane protein (Mycobacterium tuberculosis H37Rv)
VTETASETGSWRELLSRYLGTSIVLAGGVALYATNEFLTISLLPSTIADIGGSRLYAWVT
TLYLVGSVVAATTVNTMLLRVGARSSYLMGLAVFGLASLVCAAAPSMQILVAGRTLQGIA
GGLLAGLGYALINSTLPKSLWTRGSALVSAMWGVATLIGPATGGLFAQLGLWRWAFGVMT
LLTALMAMLVPVALGAGGVGPGGETPVGSTHKVPVWSLLLMGAAALAISVAALPNYLVQT
AGLLAAAALLVAVFVVVDWRIHAAVLPPSVFGSGPLKWIYLTMSVQMIAAMVDTYVPLFG
QRLGHLTPVAAGFLGAALAVGWTVGEVASASLNSARVIGHVVAAAPLVMASGLALGAVTQ
RADAPVGIIALWALALLIIGTGIGIAWPHLTVRAMDSVADPAESSAAAAAINVVQLISGA
FGAGLAGVVVNTAKGGEVAAARGLYMAFTVLAAAGVIASYQATHRDRRLPR