Protein Info for Rv1624c in Mycobacterium tuberculosis H37Rv

Annotation: Probable conserved membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 195 transmembrane" amino acids 25 to 44 (20 residues), see Phobius details amino acids 50 to 73 (24 residues), see Phobius details amino acids 82 to 99 (18 residues), see Phobius details amino acids 105 to 127 (23 residues), see Phobius details amino acids 138 to 156 (19 residues), see Phobius details amino acids 162 to 186 (25 residues), see Phobius details PF03729: DUF308" amino acids 30 to 99 (70 residues), 45.2 bits, see alignment E=4.5e-16 amino acids 86 to 155 (70 residues), 30.8 bits, see alignment E=1.5e-11 amino acids 143 to 191 (49 residues), 33.1 bits, see alignment E=2.7e-12

Best Hits

KEGG orthology group: None (inferred from 100% identity to mbb:BCG_1662c)

Predicted SEED Role

"Possible membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (195 amino acids)

>Rv1624c Probable conserved membrane protein (Mycobacterium tuberculosis H37Rv)
MCHTAPMEPSPVVSPLPRLLPHLWKSTLASGILSLILGVLVLAWPGISILVAAMAFGVYL
LITGVAQVAFAFSLHVSAGGRILLFISGAASLILAVLAFRHFGDAVLLLAIWIGIGFIFR
GVATTVSAISDPMLPGRGWSIFVGVISLIAGIVVMASPFESIWILALVVGIWLVVIGTCE
IASSFAIRKASQTLG