Protein Info for Rv1623c in Mycobacterium tuberculosis H37Rv

Annotation: Probable integral membrane cytochrome D ubiquinol oxidase (subunit I) CydA (cytochrome BD-I oxidase subunit I)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 485 transmembrane" amino acids 17 to 41 (25 residues), see Phobius details amino acids 53 to 71 (19 residues), see Phobius details amino acids 91 to 116 (26 residues), see Phobius details amino acids 124 to 146 (23 residues), see Phobius details amino acids 183 to 207 (25 residues), see Phobius details amino acids 225 to 243 (19 residues), see Phobius details amino acids 339 to 361 (23 residues), see Phobius details amino acids 373 to 394 (22 residues), see Phobius details amino acids 429 to 451 (23 residues), see Phobius details PF01654: Cyt_bd_oxida_I" amino acids 6 to 460 (455 residues), 522.2 bits, see alignment E=4.1e-161

Best Hits

KEGG orthology group: K00425, cytochrome bd-I oxidase subunit I [EC: 1.10.3.-] (inferred from 100% identity to mtb:TBMG_02371)

Predicted SEED Role

"Cytochrome d ubiquinol oxidase subunit I (EC 1.10.3.-)" in subsystem Terminal cytochrome d ubiquinol oxidases or Terminal cytochrome oxidases (EC 1.10.3.-)

Isozymes

Compare fitness of predicted isozymes for: 1.10.3.-

Use Curated BLAST to search for 1.10.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (485 amino acids)

>Rv1623c Probable integral membrane cytochrome D ubiquinol oxidase (subunit I) CydA (cytochrome BD-I oxidase subunit I) (Mycobacterium tuberculosis H37Rv)
MNVVDISRWQFGITTVYHFIFVPLTIGLAPLIAVMQTLWVVTDNPAWYRLTKFFGKLFLI
NFAIGVATGIVQEFQFGMNWSEYSRFVGDVFGAPLAMEGLAAFFFESTFIGLWIFGWNRL
PRLVHLACIWIVAIAVNVSAFFIIAANSFMQHPVGAHYNPTTGRAELSSIVVLLTNNTAQ
AAFTHTVSGALLTAGTFVAAVSAWWLVRSSTTHADSDTQAMYRPATILGCWVALAATAGL
LFTGDHQGKLMFQQQPMKMASAESLCDTQTDPNFSVLTVGRQNNCDSLTRVIEVPYVLPF
LAEGRISGVTLQGIRDLQQEYQQRFGPNDYRPNLFVTYWSFRMMIGLMAIPVLFALIALW
LTRGGQIPNQRWFSWLALLTMPAPFLANSAGWVFTEMGRQPWVVVPNPTGDQLVRLTVKA
GVSDHSATVVATSLLMFTLVYAVLAVIWCWLLKRYIVEGPLEHDAEPAAHGAPRDDEVAP
LSFAY