Protein Info for Rv1621c in Mycobacterium tuberculosis H37Rv

Annotation: Probable 'component linked with the assembly of cytochrome' transport transmembrane ATP-binding protein ABC transporter CydD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 527 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 39 to 58 (20 residues), see Phobius details amino acids 115 to 137 (23 residues), see Phobius details amino acids 143 to 162 (20 residues), see Phobius details amino acids 168 to 189 (22 residues), see Phobius details amino acids 221 to 243 (23 residues), see Phobius details amino acids 248 to 270 (23 residues), see Phobius details TIGR02857: thiol reductant ABC exporter, CydD subunit" amino acids 9 to 520 (512 residues), 503 bits, see alignment E=6.2e-155 PF00664: ABC_membrane" amino acids 14 to 257 (244 residues), 53.1 bits, see alignment E=5.9e-18 PF00005: ABC_tran" amino acids 333 to 477 (145 residues), 93.8 bits, see alignment E=2.2e-30

Best Hits

KEGG orthology group: K06148, ATP-binding cassette, subfamily C, bacterial (inferred from 100% identity to mbb:BCG_1659c)

Predicted SEED Role

"Transport ATP-binding protein CydD" in subsystem Terminal cytochrome d ubiquinol oxidases or Terminal cytochrome oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (527 amino acids)

>Rv1621c Probable 'component linked with the assembly of cytochrome' transport transmembrane ATP-binding protein ABC transporter CydD (Mycobacterium tuberculosis H37Rv)
VACGVGISGCAIGSAIVLASIVAGVIDPANPGMAGLRRWLGPLSILLVLWGLRASIQWLQ
ARLAQRGASAVIADLSGQVLTAVTARRPSQLAAQRDAAAVLITRGLDGLRPYFTGYLPTL
LLAAILTPATVAVIGLYDLKSMAIVVITLPLIPIFMVLIGLATTNPSAAALAAMTAVQAR
LLDLIAGIPTLRALGRASGPEQRIAELSADHRRSAMATLRIAFLSALVLELLATLGVALV
AVGIGLRLVFGEMSLTAGLTVLLLAPEVYWPLRRVGVQFHAAADGRTAADKAFALLGESP
SPTPGRRTVTARGGVIRLERLSVRGRDGRAPYDLTADIEPGRVTVLTGRNGAGKSTTLQA
IAGLTAPSSGRITVAGVDVTNLAPAAWWRQLSWLPQRPVLVPGTVRHNLVLLGPVDDLER
ACAAAGFDAVLDELPRGLDTVLGRGGVGLSLGQRQRLGLARALGSPAAVLLLDEPTAHLD
ARTEQHVLGAIVERARAGATVLVVAHRQQVAAAGDRVVEVNSDGFRR