Protein Info for Rv1620c in Mycobacterium tuberculosis H37Rv

Annotation: Probable 'component linked with the assembly of cytochrome' transport transmembrane ATP-binding protein ABC transporter CydC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 576 transmembrane" amino acids 28 to 53 (26 residues), see Phobius details amino acids 62 to 82 (21 residues), see Phobius details amino acids 143 to 163 (21 residues), see Phobius details amino acids 169 to 188 (20 residues), see Phobius details amino acids 258 to 278 (21 residues), see Phobius details amino acids 284 to 306 (23 residues), see Phobius details TIGR02868: thiol reductant ABC exporter, CydC subunit" amino acids 18 to 541 (524 residues), 563 bits, see alignment E=3.4e-173 PF00005: ABC_tran" amino acids 361 to 506 (146 residues), 86.8 bits, see alignment E=2.2e-28

Best Hits

KEGG orthology group: K06148, ATP-binding cassette, subfamily C, bacterial (inferred from 100% identity to mtu:Rv1620c)

Predicted SEED Role

"Transport ATP-binding protein CydC" in subsystem Terminal cytochrome d ubiquinol oxidases or Terminal cytochrome oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (576 amino acids)

>Rv1620c Probable 'component linked with the assembly of cytochrome' transport transmembrane ATP-binding protein ABC transporter CydC (Mycobacterium tuberculosis H37Rv)
MNRPSAVSRRQRDLLAASGLLGPRLPRILAAVALGVLSLGSALALAGVSAWLITRAWQMP
PVLDLSVAVVAVRAFAISRGVLHYCERLATHDTALRAAGRARTLIYHRLAHGPAAAAVGL
HSGDLAARVGADVDELANMLVRALVPIAVAAVLAVAATAVVAAVSVPAAVVLAVCLLVAG
VVAPWLAGRTAAAQEAIARQHRGMRDTSAMIALEHAPELRVAGALRNVIADSQRRQHAWA
DALDAAARTGAIAEAMPTAAIGASLLGAVVAGIGMAPTVAPTTLAILMLLPLSAFEATVA
LPAAAVQLTRSRIAAARLLDLTGSNRVRETESTVSARLPVGTGVLAADVCCGHQEAQSIR
VTIDLPPGARLAVTGASGAGKTTLLMTLAGLLPPVHGRVLLDGTNLSDFDEDELRSAVSF
FAEDAHIFATTVRDNLLTARGDCPDDELIEALDRVGLCGWLAGLPEGLSTVLIGGAQAVS
AGQRRRLLLARAVLSPARIVLLDEPVEHLDAANADLLRDLLAPNSGIMSAMRTVVVATHH
LPNDIQCAELSIATDQRCRRRGTNSSDNNTNASAKT