Protein Info for Rv1618 in Mycobacterium tuberculosis H37Rv

Annotation: Probable acyl-CoA thioesterase II TesB1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 TIGR00189: acyl-CoA thioesterase II" amino acids 17 to 287 (271 residues), 299.8 bits, see alignment E=1e-93 PF02551: Acyl_CoA_thio" amino acids 23 to 111 (89 residues), 32.5 bits, see alignment E=1.1e-11 amino acids 154 to 285 (132 residues), 163.6 bits, see alignment E=3.4e-52 PF13622: 4HBT_3" amino acids 38 to 114 (77 residues), 46.1 bits, see alignment E=7.2e-16 PF20789: 4HBT_3C" amino acids 154 to 285 (132 residues), 83.1 bits, see alignment E=3.3e-27

Best Hits

KEGG orthology group: K10805, acyl-CoA thioesterase II [EC: 3.1.2.-] (inferred from 100% identity to mra:MRA_1628)

Predicted SEED Role

"Acyl-CoA thioesterase II (EC 3.1.2.-)" (EC 3.1.2.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.2.-

Use Curated BLAST to search for 3.1.2.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (300 amino acids)

>Rv1618 Probable acyl-CoA thioesterase II TesB1 (Mycobacterium tuberculosis H37Rv)
VPDGKPMSDFDELLAVLDLNAVASDLFTGSHPSKNPLRTFGGQLMAQSFVASSRTLTRHH
LPPSAFSVHFINGGDTAKDIEFQVIRLRDERRFANRRVDAVQDGTLLSSAMVSYMAGGRG
HEHALDPPQVAEPHTRPPIGELLRGYEETVPHFVNALQPIEWRYANDPAWIMRDKGDRLA
YNRVWVKALGEMPDDPVLHTATLLYSSDTTVLDSVITTHGLSWGFDRIFAASANHSVWFH
RQVNFDDWVLYSTSSPVAADSRGLGSGHFFDRSGKLIATVVQEGVLKYFPATPDSAAGRS