Protein Info for Rv1617 in Mycobacterium tuberculosis H37Rv

Annotation: Probable pyruvate kinase PykA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01064: pyruvate kinase
  • amino acids 3 to 467 (465 residues), 571.2 bits, E=7.3e-176
• PF00224: PK
  • amino acids 3 to 323 (321 residues), 380.4 bits, E=7.3e-118
• PF02887: PK_C
  • amino acids 354 to 465 (112 residues), 90.7 bits, E=7.1e-30

Best Hits

Swiss-Prot: 100% identical to KPYK_MYCTU: Pyruvate kinase (pyk) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K00873, pyruvate kinase [EC: 2.7.1.40] (inferred from 100% identity to mbo:Mb1643)

Predicted SEED Role

"Pyruvate kinase (EC 2.7.1.40)" in subsystem Entner-Doudoroff Pathway or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes or Pyruvate metabolism I: anaplerotic reactions, PEP (EC 2.7.1.40)

MetaCyc Pathways

• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (22/26 steps found)
• glycolysis II (from fructose 6-phosphate) (11/11 steps found)
• glycolysis III (from glucose) (11/11 steps found)
• glycolysis I (from glucose 6-phosphate) (12/13 steps found)
• homolactic fermentation (11/12 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (16/19 steps found)
• superpathway of anaerobic sucrose degradation (16/19 steps found)
• anaerobic energy metabolism (invertebrates, cytosol) (7/7 steps found)
• superpathway of glucose and xylose degradation (14/17 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (14/17 steps found)
• mixed acid fermentation (13/16 steps found)
• Bifidobacterium shunt (12/15 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (17/22 steps found)
• superpathway of hexitol degradation (bacteria) (14/18 steps found)
• Rubisco shunt (8/10 steps found)
• glycolysis IV (8/10 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (13/17 steps found)
• Entner-Doudoroff pathway I (7/9 steps found)
• superpathway of N-acetylneuraminate degradation (16/22 steps found)
• glycolysis VI (from fructose) (8/11 steps found)
• heterolactic fermentation (13/18 steps found)
• glycolysis V (Pyrococcus) (7/10 steps found)
• glycerol degradation to butanol (10/16 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (17/27 steps found)
• Entner-Doudoroff pathway II (non-phosphorylative) (4/9 steps found)
• Entner-Doudoroff pathway III (semi-phosphorylative) (4/9 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (15/26 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Carbon fixation in photosynthetic organisms
• Glycolysis / Gluconeogenesis
• Purine metabolism
• Pyruvate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.40

Protein Sequence (472 amino acids)

>Rv1617 Probable pyruvate kinase PykA (Mycobacterium tuberculosis H37Rv)
VTRRGKIVCTLGPATQRDDLVRALVEAGMDVARMNFSHGDYDDHKVAYERVRVASDATGR
AVGVLADLQGPKIRLGRFASGATHWAEGETVRITVGACEGSHDRVSTTYKRLAQDAVAGD
RVLVDDGKVALVVDAVEGDDVVCTVVEGGPVSDNKGISLPGMNVTAPALSEKDIEDLTFA
LNLGVDMVALSFVRSPADVELVHEVMDRIGRRVPVIAKLEKPEAIDNLEAIVLAFDAVMV
ARGDLGVELPLEEVPLVQKRAIQMARENAKPVIVATQMLDSMIENSRPTRAEASDVANAV
LDGADALMLSGETSVGKYPLAAVRTMSRIICAVEENSTAAPPLTHIPRTKRGVISYAARD
IGERLDAKALVAFTQSGDTVRRLARLHTPLPLLAFTAWPEVRSQLAMTWGTETFIVPKMQ
STDGMIRQVDKSLLELARYKRGDLVVIVAGAPPGTVGSTNLIHVHRIGEDDV