Protein Info for Rv1614 in Mycobacterium tuberculosis H37Rv

Annotation: Possible prolipoprotein diacylglyceryl transferases Lgt

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 468 transmembrane" amino acids 23 to 41 (19 residues), see Phobius details amino acids 53 to 74 (22 residues), see Phobius details amino acids 96 to 116 (21 residues), see Phobius details amino acids 125 to 143 (19 residues), see Phobius details amino acids 196 to 214 (19 residues), see Phobius details amino acids 226 to 244 (19 residues), see Phobius details amino acids 250 to 274 (25 residues), see Phobius details PF01790: LGT" amino acids 15 to 273 (259 residues), 197.5 bits, see alignment E=1.1e-62 TIGR00544: prolipoprotein diacylglyceryl transferase" amino acids 15 to 273 (259 residues), 130.7 bits, see alignment E=3.6e-42

Best Hits

Swiss-Prot: 100% identical to LGT_MYCBT: Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase (lgt) from Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)

KEGG orthology group: None (inferred from 100% identity to mtf:TBFG_11630)

Predicted SEED Role

"Prolipoprotein diacylglyceryl transferase (EC 2.4.99.-)" (EC 2.4.99.-)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.99.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (468 amino acids)

>Rv1614 Possible prolipoprotein diacylglyceryl transferases Lgt (Mycobacterium tuberculosis H37Rv)
MRMLPSYIPSPPRGVWYLGPLPVRAYAVCVITGIIVALLIGDRRLTARGGERGMTYDIAL
WAVPFGLIGGRLYHLATDWRTYFGDGGAGLAAALRIWDGGLGIWGAVTLGVMGAWIGCRR
CGIPLPVLLDAVAPGVVLAQAIGRLGNYFNQELYGRETTMPWGLEIFYRRDPSGFDVPNS
LDGVSTGQVAFVVQPTFLYELIWNVLVFVALIYIDRRFIIGHGRLFGFYVAFYCAGRFCV
ELLRDDPATLIAGIRINSFTSTFVFIGAVVYIILAPKGREAPGALRGSEYVVDEALEREP
AELAAAAVASAASAVGPVGPGEPNQPDDVAEAVKAEVAEVTDEVAAESVVQVADRDGEST
PAVEETSEADIEREQPGDLAGQAPAAHQVDAEAASAAPEEPAALASEAHDETEPEVPEKA
APIPDPAKPDELAVAGPGDDPAEPDGIRRQDDFSSRRRRWWRLRRRRQ