Protein Info for Rv1608c in Mycobacterium tuberculosis H37Rv

Annotation: Probable peroxidoxin BcpB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF08534: Redoxin
  • amino acids 2 to 143 (142 residues), 72.4 bits, E=3.7e-24
• PF00578: AhpC-TSA
  • amino acids 4 to 127 (124 residues), 113.3 bits, E=7.1e-37

Best Hits

Swiss-Prot: 100% identical to BCPB_MYCTU: Putative peroxiredoxin Rv1608c (bcpB) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K03564, peroxiredoxin Q/BCP [EC: 1.11.1.15] (inferred from 100% identity to mtu:Rv1608c)

Predicted SEED Role

"Alkyl hydroperoxide reductase subunit C-like protein" in subsystem Oxidative stress or Rubrerythrin or Thioredoxin-disulfide reductase

KEGG Metabolic Maps

• Glutathione metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.11.1.15

Use Curated BLAST to search for 1.11.1.15

Protein Sequence (154 amino acids)

>Rv1608c Probable peroxidoxin BcpB (Mycobacterium tuberculosis H37Rv)
MKTGDTVADFELPDQTGTPRRLSVLLSDGPVVLFFYPAAMTPGCTKEACHFRDLAKEFAE
VRASRVGISTDPVRKQAKFAEVRRFDYPLLSDAQGTVAAQFGVKRGLLGKLMPVKRTTFV
IDTDRKVLDVISSEFSMDAHADKALATLRAIRSG