Protein Info for Rv1607 in Mycobacterium tuberculosis H37Rv

Annotation: Probable ionic transporter integral membrane protein ChaA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 360 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 33 to 52 (20 residues), see Phobius details amino acids 62 to 84 (23 residues), see Phobius details amino acids 97 to 118 (22 residues), see Phobius details amino acids 130 to 150 (21 residues), see Phobius details amino acids 162 to 181 (20 residues), see Phobius details amino acids 212 to 231 (20 residues), see Phobius details amino acids 250 to 269 (20 residues), see Phobius details amino acids 283 to 306 (24 residues), see Phobius details amino acids 312 to 334 (23 residues), see Phobius details amino acids 341 to 359 (19 residues), see Phobius details PF01699: Na_Ca_ex" amino acids 30 to 183 (154 residues), 58.8 bits, see alignment E=3.3e-20 amino acids 216 to 358 (143 residues), 58.2 bits, see alignment E=5e-20

Best Hits

Swiss-Prot: 48% identical to Y4HA_SINFN: Putative ionic transporter y4hA (NGR_a03490) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: K07300, Ca2+:H+ antiporter (inferred from 100% identity to mra:MRA_1617)

MetaCyc: 35% identical to Na+/K+:H+ antiporter ChaA (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-101; TRANS-RXN-42

Predicted SEED Role

"Calcium/proton antiporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (360 amino acids)

>Rv1607 Probable ionic transporter integral membrane protein ChaA (Mycobacterium tuberculosis H37Rv)
MLKRVPWTVVLPSLAFVALVLTWGKQIGPVVGLLAAVLLAGAVLAAVNHAEVVAARVGEP
FGSLVLAVAVTTIEVALIVALMVSGGDDAATLARDTVFAAVMITTNGIAGLSLLLGSLRY
GVTLFNPHGSGAALATVTTLATLSLVLPTFTTSQSGPELSPGQLIFAGAASLGLYVLFLF
TQTVRHRDFFLPVAQKGAVEDDSHADPPSTRAALLSLGLLLVALVAVVGLAKVESPVIEE
VVSAAGFPQSFVGVVIATLVLLPETLAAARAARQGRLQTSLNLAYGSAMASIGLTIPTIA
LASLWLSGPLQLGLGAIQLVLLVLTVVVSVLTVVPGRATRLQGEVHLVLLAAYLFLAVVP