Protein Info for Rv1604 in Mycobacterium tuberculosis H37Rv

Annotation: Probable inositol-monophosphatase ImpA (imp)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 270 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 196 to 207 (12 residues), see Phobius details PF00459: Inositol_P" amino acids 18 to 261 (244 residues), 193 bits, see alignment E=3.6e-61

Best Hits

Swiss-Prot: 100% identical to IMPA_MYCTU: Probable inositol 1-monophosphatase ImpA (impA) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K01092, myo-inositol-1(or 4)-monophosphatase [EC: 3.1.3.25] (inferred from 100% identity to mtc:MT1640)

Predicted SEED Role

"Histidinol-phosphatase [alternative form] (EC 3.1.3.15)" in subsystem Histidine Biosynthesis (EC 3.1.3.15)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.15, 3.1.3.25

Use Curated BLAST to search for 3.1.3.15 or 3.1.3.25

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (270 amino acids)

>Rv1604 Probable inositol-monophosphatase ImpA (imp) (Mycobacterium tuberculosis H37Rv)
MHLDSLVAPLVEQASAILDAATALFLVGHRADSAVRKKGNDFATEVDLAIERQVVAALVA
ATGIEVHGEEFGGPAVDSRWVWVLDPIDGTINYAAGSPLAAILLGLLHDGVPVAGLTWMP
FTDPRYTAVAGGPLIKNGVPQPPLADAELANVLVGVGTFSADSRGQFPGRYRLAVLEKLS
RVSSRLRMHGSTGIDLVFVADGILGGAISFGGHVWDHAAGVALVRAAGGVVTDLAGQPWT
PASRSALAGPPRVHAQILEILGSIGEPEDY