Protein Info for Rv1603 in Mycobacterium tuberculosis H37Rv

Annotation: Probable phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase HisA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 245 TIGR01919: bifunctional HisA/TrpF protein" amino acids 2 to 244 (243 residues), 466.5 bits, see alignment E=9.4e-145 PF00977: His_biosynth" amino acids 6 to 234 (229 residues), 212.4 bits, see alignment E=9.5e-67

Best Hits

Swiss-Prot: 100% identical to HIS4_MYCBT: Phosphoribosyl isomerase A (priA) from Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)

KEGG orthology group: K01814, phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase [EC: 5.3.1.16] K01817, phosphoribosylanthranilate isomerase [EC: 5.3.1.24] (inferred from 100% identity to mtf:TBFG_11619)

Predicted SEED Role

"Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase (EC 5.3.1.16) / Acting phosphoribosylanthranilate isomerase (EC 5.3.1.24)" in subsystem Tryptophan synthesis or Histidine Biosynthesis (EC 5.3.1.16, EC 5.3.1.24)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.1.16 or 5.3.1.24

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (245 amino acids)

>Rv1603 Probable phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase HisA (Mycobacterium tuberculosis H37Rv)
VMPLILLPAVDVVEGRAVRLVQGKAGSQTEYGSAVDAALGWQRDGAEWIHLVDLDAAFGR
GSNHELLAEVVGKLDVQVELSGGIRDDESLAAALATGCARVNVGTAALENPQWCARVIGE
HGDQVAVGLDVQIIDGEHRLRGRGWETDGGDLWDVLERLDSEGCSRFVVTDITKDGTLGG
PNLDLLAGVADRTDAPVIASGGVSSLDDLRAIATLTHRGVEGAIVGKALYARRFTLPQAL
AAVRD