Protein Info for Rv1596 in Mycobacterium tuberculosis H37Rv

Annotation: Probable nicotinate-nucleotide pyrophosphatase NadC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00078: nicotinate-nucleotide diphosphorylase (carboxylating)
  • amino acids 15 to 285 (271 residues), 326.1 bits, E=7.8e-102
• PF02749: QRPTase_N
  • amino acids 28 to 115 (88 residues), 71.4 bits, E=5.3e-24
• PF01729: QRPTase_C
  • amino acids 117 to 284 (168 residues), 215.4 bits, E=4.3e-68

Best Hits

Swiss-Prot: 100% identical to NADC_MYCTU: Nicotinate-nucleotide pyrophosphorylase [carboxylating] (nadC) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K00767, nicotinate-nucleotide pyrophosphorylase (carboxylating) [EC: 2.4.2.19] (inferred from 100% identity to mbb:BCG_1634)

Predicted SEED Role

"Quinolinate phosphoribosyltransferase [decarboxylating] (EC 2.4.2.19)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 2.4.2.19)

MetaCyc Pathways

• aspartate superpathway (23/25 steps found)
• NAD de novo biosynthesis I (6/6 steps found)
• NAD biosynthesis from 2-amino-3-carboxymuconate semialdehyde (4/4 steps found)
• NAD de novo biosynthesis III (5/6 steps found)
• NAD de novo biosynthesis IV (anaerobic) (5/6 steps found)
• superpathway of NAD biosynthesis in eukaryotes (9/14 steps found)
• NAD de novo biosynthesis II (from tryptophan) (5/9 steps found)
• nicotine biosynthesis (3/9 steps found)
• superpathway of nicotine biosynthesis (4/12 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Nicotinate and nicotinamide metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.19

Protein Sequence (285 amino acids)

>Rv1596 Probable nicotinate-nucleotide pyrophosphatase NadC (Mycobacterium tuberculosis H37Rv)
MGLSDWELAAARAAIARGLDEDLRYGPDVTTLATVPASATTTASLVTREAGVVAGLDVAL
LTLNEVLGTNGYRVLDRVEDGARVPPGEALMTLEAQTRGLLTAERTMLNLVGHLSGIATA
TAAWVDAVRGTKAKIRDTRKTLPGLRALQKYAVRTGGGVNHRLGLGDAALIKDNHVAAAG
SVVDALRAVRNAAPDLPCEVEVDSLEQLDAVLPEKPELILLDNFAVWQTQTAVQRRDSRA
PTVMLESSGGLSLQTAATYAETGVDYLAVGALTHSVRVLDIGLDM